Recombinant Chlamydophila caviae Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolutionary Insights

The lnt gene (locus CCA_00087) in C. caviae is located in the replication termination region (RTR), a hotspot for genomic rearrangements and niche-specific adaptations . Comparative genomic analysis highlights:

  • Orthologs: Present in Shewanella oneidensis (UniProt Q8EHP1) and E. coli (UniProt Q8XBK2), with conserved catalytic domains but divergent N-terminal regions .

  • Functional Conservation: Despite species-specific variations, the core enzymatic activity remains conserved, underscoring its universal role in bacterial physiology .

Table 2: Comparative Analysis of Lnt Orthologs

SpeciesUniProt IDProtein LengthKey FeaturesSource
C. caviaeQ824Q5541 aaFull-length, no specified tag
Shewanella oneidensisQ8EHP1518 aaHis-tagged, expressed in E. coli
E. coliQ8XBK2512 aaHis-tagged, linked to copper homeostasis

Research Applications and Functional Studies

Functional Role in Pathogens:

  • Chlamydophila caviae: A zoonotic pathogen causing psittacosis in humans and birds. Lnt’s role in lipoprotein maturation may contribute to host immune evasion .

  • Mycobacteria: Lnt homologs mediate triacylation of lipoproteins, which are recognized by Toll-like receptors (TLR2/TLR6), linking bacterial lipid modifications to host immune responses .

Therapeutic and Diagnostic Potential

Lnt is a validated target for antimicrobial development, as its inhibition disrupts lipoprotein maturation and bacterial viability . Recombinant Lnt proteins enable:

  • Enzyme Inhibition Studies: High-throughput screening for small-molecule inhibitors targeting the catalytic site.

  • Vaccine Development: Lipoproteins are immunogenic; Lnt’s role in their processing makes it a candidate for subunit vaccine design .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
lnt; CCA_00087; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
lnt
Target Protein Sequence
MFRILSFLCSWILIAFAQPDMSWFFSLLGSAVGYGLLWYSLEPQKSPKLSWRQLTSLLFL WSVTVYGVHFSWMLSDLYVGKFIYVVWGVLISLLALLFTAFSCLLFFIVRKKHTKILWCL PGLWVAVEMVRFYFLCSGMSLDYLGWPITANAYGRQFGGFFGWAGESFILVATGISFYQV LLRKCFSRYVWLGCLLFPYILGGVHYEYLKNTFSKEENLRVAVIQPASSMLLEGPWSGSP AMAWQRLVSLSSIVRKPVDLLIFPEVSVPFGRDRKVYPYDDSQVILSPLTHFKHQDELLA NVDWMQALSNHFNCPILMGLERWEELDSKLHLYNSAECISQHGELIGYDKRILVPGGEYI PGGKIGWSVCKKYFPEYALSCQRIPGARSGVIEVENLPKMGVSICYEETFGMLLRNYKRE GAKLLVNLTNDGWYPSSRLPQVHFYHGILRNQELGMPCVRSCHTGITVAADALGRVIKML PYETRYRKASPGVLQVSLPMQNYPTLYAFWGDFPMIFLSLLSIGCIGCYFGYRLLAKKEK A
Uniprot No.

Target Background

Function
Apolipoprotein N-acyltransferase (lnt) from Chlamydophila caviae plays a crucial role in lipoprotein maturation. It catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in this essential process.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its function in Chlamydophila caviae?

Apolipoprotein N-acyltransferase (lnt) is an integral membrane enzyme that catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in bacterial lipoprotein maturation. In Chlamydophila caviae strain GPIC, lnt is 541 amino acids in length with a molecular mass of 61.8 kDa . The enzyme belongs to the CN hydrolase family, Apolipoprotein N-acyltransferase subfamily .

Functionally, lnt operates through a two-step ping-pong mechanism:

  • Formation of a thioester acyl-enzyme intermediate with a phospholipid substrate

  • Transfer of the acyl chain to the α-amino group of the N-terminal diacylglyceryl-modified cysteine of the apolipoprotein

This post-translational modification is crucial for proper lipoprotein sorting, localization, and function within the bacterial cell envelope. In C. caviae, this process is particularly important for maintaining envelope integrity and mediating host-pathogen interactions during infection .

How does the structure of Chlamydophila caviae lnt compare to lnt in other bacterial species?

C. caviae lnt shares structural conservation with other bacterial lnt enzymes but exhibits species-specific characteristics. Based on sequence analysis and structural studies, the following comparisons can be made:

  • Conserved domains: C. caviae lnt contains the nitrilase domain characteristic of the lnt family, which harbors the catalytic triad (Glu-Lys-Cys) essential for enzymatic activity .

  • Membrane topology: Similar to Escherichia coli lnt, C. caviae lnt is an integral membrane protein with transmembrane helices anchoring the enzyme to the bacterial inner membrane .

  • Structural features: Crystal structures of lnt from different bacterial species (though not specifically C. caviae) reveal conformational changes during substrate binding. These include:

    • A highly dynamic arm that restricts access to the active site

    • Distinct conformational states during the catalytic cycle

    • Movement of essential loops and residues triggered by substrate binding

Evolutionary analysis indicates that while lnt was previously thought to be restricted to Gram-negative bacteria, homologues have been identified in high-GC Gram-positive bacteria including Actinobacteria . The functional presence of lnt in Chlamydophila, an obligate intracellular pathogen, suggests evolutionary adaptation for specialized lipoprotein processing in this unique ecological niche .

What is the catalytic mechanism of Chlamydophila caviae lnt?

The catalytic mechanism of C. caviae lnt follows a ping-pong bi-bi reaction scheme common to the lnt family but with specific kinetic parameters. Based on enzymatic studies of purified recombinant lnt:

Step 2: N-acyl transfer

  • The α-amino group of the apolipoprotein's N-terminal cysteine attacks the thioester bond

  • This transfers the acyl chain to the apolipoprotein

  • This step proceeds rapidly compared to intermediate formation

The mechanism involves significant specificity for both substrates:

  • Phospholipid specificity: Unlike earlier in vitro observations, lnt activity is strongly affected by both phospholipid headgroup and acyl chain composition

  • Apolipoprotein recognition: The diacylglyceryl group of the apolipoprotein serves as a recognition element for substrate binding

Kinetic analyses using synthetic lipopeptide substrates like FSL-1 reveal this ping-pong mechanism operates with distinct rate constants for each step, demonstrating a coordinated but sequential substrate interaction pattern .

What expression systems and purification strategies are most effective for producing functional recombinant Chlamydophila caviae lnt?

Obtaining functional recombinant C. caviae lnt requires carefully optimized expression and purification protocols to preserve the enzyme's membrane association and catalytic activity.

Effective Expression Systems:

  • E. coli-based systems: Most studies utilize E. coli for heterologous expression, particularly strains optimized for membrane protein expression such as C41(DE3) or C43(DE3)

  • Vector selection: pET-based vectors with T7 promoters provide controlled, high-level expression

  • Expression conditions: Induction with low IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-20°C) helps prevent inclusion body formation

Purification Strategy:

  • Membrane fraction isolation:

    • Cell disruption via French press or sonication

    • Differential centrifugation to separate membranes (typically 100,000×g ultracentrifugation)

    • Membrane solubilization using detergents

  • Detergent selection is critical:

    • n-Dodecyl β-D-maltoside (DDM) at 1-2% effectively solubilizes lnt while maintaining activity

    • Triton X-100 (0.1%) is also used in activity assays

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Ion exchange chromatography (SP column with pH 6.0 buffer)

    • Size exclusion chromatography for final polishing

  • Buffer optimization:

    • Inclusion of glycerol (10%) stabilizes the enzyme

    • Addition of reducing agents (0.5 mM TCEP) protects the active site cysteine

Quality Control Assessment:

  • Western blotting with anti-lnt antibodies

  • Activity assays using synthetic lipopeptide substrates

  • Mass spectrometry to confirm formation of the thioester acyl-enzyme intermediate

Researchers should note that the yield of active enzyme is typically modest (1-2 mg/L culture) due to the challenges inherent in membrane protein expression and purification.

What in vitro assays are available to study the enzymatic activity of recombinant C. caviae lnt?

Several complementary assays have been developed to assess the activity of recombinant lnt, each providing insights into different aspects of the enzyme's function:

Thioester Acyl-Enzyme Intermediate Formation Assay

  • Principle: Monitors formation of the covalent thioester intermediate on the catalytic cysteine

  • Method:

    • Incubation of purified lnt with phospholipids

    • Analysis by SDS-PAGE under non-reducing conditions

    • Visualization using mass spectrometry or radiolabeled phospholipids

  • Applications: Confirms the first step of the reaction mechanism is functional

Synthetic Lipopeptide Acylation Assay

  • Principle: Measures transfer of acyl chains to synthetic lipopeptide substrates

  • Method:

    • Incubation of lnt with phospholipids and synthetic diacylglyceryl-modified lipopeptides (e.g., FSL-1)

    • Analysis by mass spectrometry to detect mass shift upon N-acylation

    • Alternatively, incorporation of [³H]palmitate followed by radiometric detection

  • Applications: Quantitatively determines enzyme kinetics and substrate preferences

SAMDI Mass Spectrometry Assay

  • Principle: Quantifies conversion of diacylated to triacylated peptides

  • Method:

    • Reaction mixtures analyzed using SAMDI (self-assembled monolayers with matrix-assisted laser desorption/ionization) mass spectrometry

    • Fraction conversion calculated as: AUC triacylated/(AUC triacylated + AUC diacylated)

  • Applications: High-throughput analysis of reaction kinetics and substrate preferences

Apo-Lipoprotein Conversion Assay

  • Principle: Tracks conversion of apo-form to mature lipoproteins

  • Method:

    • Uses membranes from lnt-depleted cells containing accumulated apo-lipoproteins

    • Addition of purified lnt and monitoring of apo- to mature lipoprotein conversion

    • Analysis by SDS-PAGE and immunoblotting with anti-lipoprotein antibodies

  • Applications: Assesses activity using native substrates

Standard Reaction Conditions:

  • Buffer: 50 mM Tris-HCl (pH 7.2-7.5), 150 mM NaCl, 0.1% Triton X-100

  • Temperature: 37°C

  • Enzyme concentration: 10 ng/μl

  • Reaction time: Varies from minutes to hours depending on the assay

These assays can be adapted to investigate inhibitors, substrate specificity, and the effects of mutations on enzyme activity.

How is substrate specificity determined for C. caviae lnt and how does it affect experimental design?

Understanding and accounting for the substrate preferences of C. caviae lnt is crucial for developing accurate activity assays and interpreting experimental results.

Phospholipid Substrate Specificity:

Contrary to earlier assumptions, lnt exhibits strong preferences for both phospholipid headgroups and acyl chain compositions:

  • Headgroup preference: Phosphatidylethanolamine (PE) is the preferred donor, with significantly higher activity compared to phosphatidylglycerol (PG) or phosphatidylcholine (PC)

  • Acyl chain preference: Chain length and saturation affect catalytic efficiency, with C16-C18 chains typically showing optimal activity

  • Experimental implications:

    • Include PE as the primary phospholipid substrate in activity assays

    • Consider using prokaryotic PE sources that contain appropriate acyl chain compositions

    • Maintain proper lipid:detergent ratios (typically 1:5) to ensure substrate accessibility

Apolipoprotein Substrate Recognition:

Features influencing substrate recognition include:

  • Signal sequence: The diacylglyceryl-modified N-terminal cysteine is essential for recognition

  • Amino acid context: Residues adjacent to the modified cysteine influence binding affinity

  • Experimental implications:

    • Synthetic substrates like FSL-1 containing the diacylglyceryl group can effectively model natural substrates

    • For kinetic studies, peptide length affects binding; both short (Pam2Cys-SSNKNGGK-Biotin) and long (Pam2Cys-SSNKNASNDGSEGMLGAGTGMDK-Biotin) synthetic peptides have been used

Experimental Design Considerations:

  • Kinetic analysis:

    • Use a range of substrate concentrations (typically 0.1-100 μM)

    • Plot data using Lineweaver-Burk or direct fitting to ping-pong mechanism equations

    • Global fitting approaches can distinguish between ping-pong and ternary complex mechanisms

  • Assay conditions optimization:

    • Detergent selection significantly impacts activity (DDM and Triton X-100 are most commonly used)

    • Include bovine skin gelatin (0.05%) to prevent enzyme adsorption to plastic surfaces

    • Maintain reducing conditions (1 mM TCEP or DTT) to protect the catalytic cysteine

  • Controls for specificity:

    • Include site-directed mutants of the catalytic cysteine as negative controls

    • Consider active-site competitive inhibitors as additional controls

    • Compare activity with structurally related enzymes (e.g., E. coli lnt)

Understanding these specificity parameters ensures proper experimental design and interpretation of results when studying C. caviae lnt.

What are the implications of lnt inhibition for Chlamydophila caviae pathogenesis and potential therapeutic applications?

Inhibition of lnt in C. caviae has significant implications for bacterial physiology and host-pathogen interactions, making it a potential therapeutic target. Understanding these implications requires integrating knowledge from related chlamydial species and other bacteria where lnt function has been studied more extensively.

Effects on Bacterial Physiology and Virulence:

  • Lipoprotein maturation: Inhibition of lnt disrupts the final step of lipoprotein processing, resulting in accumulation of diacylated (rather than triacylated) lipoproteins

  • Membrane integrity: Improper lipoprotein modification affects membrane organization and stability, potentially compromising the bacterial envelope

  • Inclusion membrane proteins: In chlamydial species, several important inclusion membrane proteins (Incs) are lipoproteins. Disruption of lnt may affect their localization and function

  • Immune recognition:

    • Triacylated lipoproteins are recognized by TLR2/TLR1 heterodimers

    • Diacylated lipoproteins are primarily recognized by TLR2/TLR6 heterodimers

    • This difference could alter host immune responses to infection

  • Pathogenesis-related effects:

    • Studies with plasmid-cured C. caviae (strain CC13) show that TLR2-dependent signaling remains intact even when other bacterial functions are compromised

    • This suggests C. caviae may have redundant mechanisms for immune activation, which could complicate therapeutic strategies targeting lnt alone

Therapeutic Potential:

  • Antibiotic susceptibility enhancement:

    • In other bacteria, lnt mutants show increased sensitivity to certain antibiotics

    • For example, in Neisseria meningitidis, an lnt mutant exhibited 64-fold and 16-fold increases in susceptibility to rifampicin and ciprofloxacin, respectively

    • This suggests lnt inhibitors could potentiate existing antibiotics against C. caviae

  • Combined therapy approaches:

    • Targeting lnt in combination with conventional antibiotics may enhance treatment efficacy

    • Particularly valuable for intracellular pathogens like C. caviae that are difficult to treat with conventional antibiotics alone

  • Immune modulation:

    • Altering lipoprotein acylation patterns may modify host immune responses

    • This could potentially reduce inflammatory damage during infection

Experimental Models to Assess lnt Inhibition:

  • In vitro infection models:

    • Cell culture systems using McCoy cells or other permissive cell lines

    • Evaluation of inclusion formation, bacterial replication, and host cell responses

  • Guinea pig models:

    • C. caviae naturally infects guinea pigs, providing a relevant animal model

    • Assessment of infection progression and inflammatory responses in vivo

    • Standard protocols involve inoculation of female Hartley strain guinea pigs (typically 20-week-old)

  • Compound screening approaches:

    • Development of high-throughput assays to identify lnt inhibitors

    • Evaluation of identified compounds in cellular and animal models

    • Assessment of synergy with existing antibiotics

The therapeutic potential of targeting lnt in C. caviae represents an underexplored area that merits further investigation, particularly as a strategy to enhance conventional antibiotic efficacy.

How can structural data on lnt be used for rational drug design targeting C. caviae infections?

Structural insights into lnt provide a foundation for structure-based drug design approaches. While crystal structures specifically of C. caviae lnt are not directly reported in the provided search results, structural information from homologous lnt enzymes can guide rational inhibitor development.

Key Structural Features for Drug Design:

  • Active site architecture:

    • The catalytic triad (Glu-Lys-Cys) forms a well-defined pocket suitable for small molecule binding

    • The nucleophilic cysteine is particularly targetable due to its reactivity

    • Structures showing the thioester acyl-intermediate provide templates for transition-state mimics

  • Substrate binding sites:

    • The phospholipid binding site shows specificity for certain headgroups and acyl chains

    • The apolipoprotein binding region contains a portal-like structure with dynamic elements

    • Both sites offer opportunities for competitive inhibitor design

  • Conformational dynamics:

    • Crystal structures reveal significant conformational changes during catalysis

    • The movement of conserved residues (e.g., W237) controls substrate access

    • These dynamic features can be exploited for designing allosteric inhibitors

Rational Drug Design Strategies:

  • Structure-based virtual screening:

    • Use homology models of C. caviae lnt based on crystal structures from related species

    • Perform molecular docking against large compound libraries

    • Filter compounds based on predicted binding energy and interactions with key residues

    • Target sites: catalytic pocket, phospholipid binding site, apolipoprotein binding portal

  • Fragment-based drug discovery:

    • Screen fragment libraries against lnt using biophysical methods (thermal shift assays, NMR)

    • Identify fragments binding to different sites on the enzyme

    • Link or grow fragments to develop high-affinity inhibitors

  • Transition state analog design:

    • Design compounds mimicking the thioester acyl-enzyme intermediate

    • Focus on electrophilic compounds that can form stable covalent bonds with the catalytic cysteine

    • Example scaffold: β-lactones or peptidyl-phosphonates

  • Allosteric inhibitor development:

    • Target the dynamic regions that control substrate access (e.g., the flexible loop containing W237)

    • Design compounds that lock the enzyme in inactive conformations

    • Potentially more selective than active site inhibitors

Experimental Validation Pipeline:

  • Biochemical screening:

    • Primary assays: SAMDI-MS or synthetic lipopeptide acylation assays

    • Secondary assays: Apolipoprotein conversion assays with natural substrates

    • Counter-screening against human enzymes to assess selectivity

  • Structural confirmation:

    • X-ray crystallography of lnt-inhibitor complexes

    • HDX-MS to assess effects on protein dynamics

    • Site-directed mutagenesis to validate binding mode predictions

  • Cellular evaluation:

    • Assessment of compound permeability to reach intracellular bacteria

    • Evaluation of growth inhibition in C. caviae-infected cells

    • Analysis of lipoprotein processing in treated bacteria

  • Lead optimization:

    • Medicinal chemistry optimization for improved pharmacokinetics

    • Testing in combination with conventional antibiotics

    • Evaluation in animal models (guinea pig infection models)

This rational approach leverages structural insights to develop specific inhibitors of C. caviae lnt that could form the basis for novel therapeutic strategies.

What are the evolutionary implications of lnt conservation across diverse bacterial species including C. caviae?

The evolutionary conservation of lnt across diverse bacterial taxa, including C. caviae, provides insights into bacterial adaptation, host-pathogen interactions, and the fundamental importance of lipoprotein processing.

Phylogenetic Distribution and Evolutionary History:

  • Taxonomic distribution:

    • Originally thought to be restricted to Gram-negative bacteria

    • Now identified in high-GC Gram-positive bacteria (Actinobacteria including Mycobacteria)

    • Present in the evolutionarily distinct Chlamydiae phylum

    • Absent from low-GC Gram-positive bacteria (Firmicutes)

  • Conservation within Chlamydiales:

    • lnt sequences are highly conserved across chlamydial species

    • Sequence analysis shows high conservation in C. trachomatis, C. muridarum, C. pneumoniae, and C. caviae

    • Even distant relatives like "Candidatus Protochlamydia amoebophila" (an environmental chlamydia that diverged ~700 million years ago) retain recognizable lnt homologs

  • Selective pressures:

    • The conservation suggests strong selective pressure to maintain lipoprotein triacylation

    • This is likely related to the crucial roles of lipoproteins in bacterial envelope integrity and host interactions

Functional Evolution:

  • Structural adaptations:

    • Conservation of the nitrilase-like catalytic domain across diverse bacteria

    • Species-specific adaptations in substrate binding regions

    • Differences in membrane topology between bacterial groups

  • Substrate co-evolution:

    • Adaptation to available phospholipids in different bacterial membranes

    • Co-evolution with species-specific lipoproteins, particularly those involved in host interactions

  • Functional redundancy:

    • Some bacteria show evidence of redundant pathways for lipoprotein processing

    • For example, plasmid-cured C. caviae (strain CC13) maintains TLR2 activation despite other functional changes

    • This suggests evolutionary pressure to maintain certain lipoprotein functions even when genetic elements are lost

Implications for Understanding Bacterial Adaptation:

  • Host-pathogen interface:

    • Triacylated lipoproteins interact with host TLR2/TLR1 receptors, while diacylated forms are recognized by TLR2/TLR6

    • The conservation of lnt in intracellular pathogens like C. caviae suggests selection for specific host immune interactions

  • Cellular compartmentalization:

    • In Chlamydiales, proper lipoprotein processing may be crucial for inclusion membrane organization

    • Translocated lipoproteins may play important roles in controlling host-pathogen interfaces

  • Antibiotic resistance mechanisms:

    • The correlation between lnt mutation and increased antibiotic sensitivity in some bacteria suggests evolutionary links between lipoprotein processing and drug resistance

    • Conservation of lnt across diverse species despite this potential vulnerability underscores its essential nature

  • Evolutionary adaptation of obligate intracellular bacteria:

    • Despite genome reduction in obligate intracellular bacteria like Chlamydiae, lnt has been retained

    • This suggests its function cannot be compensated by host factors or alternative bacterial pathways

Understanding the evolutionary context of lnt provides valuable insights for both fundamental microbiology and potential therapeutic development targeting this conserved bacterial system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.