Recombinant Chlamydophila caviae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Chlamydophila caviae Lipoprotein signal peptidase (lspA) is a bacterial enzyme engineered for research applications. It catalyzes the cleavage of signal peptides from prolipoproteins, a critical step in lipoprotein maturation. This enzyme, classified as Signal Peptidase II (SPase II; EC 3.4.23.36), is essential for the post-translational modification of bacterial membrane proteins, enabling lipid anchoring and proper localization .

Table 1: Comparative Genomic Features of lspA Across Chlamydiae

SpeciesGene LocusProtein Length (aa)Lipobox MotifUniProt ID
C. caviae (GPIC)CCA_00210165MNRRWNLVLATQ824E2
C. trachomatis (D/UW-3)CT541163MKNILSWMLMP26623
C. pneumoniae (AR39)CPn0661168MNRRWNLVLATQ9Z7P3
Data derived from genomic analyses .

Lipid Modification

Studies using site-directed mutagenesis (e.g., C20A substitution) demonstrated that cysteine residues in the lipobox are essential for lipid attachment. Gas chromatography-mass spectrometry confirmed palmitic acid and glycerol modifications, consistent with prokaryotic lipoprotein processing .

Role in Pathogenicity

C. caviae lspA contributes to virulence by facilitating outer membrane protein assembly. Mutants lacking functional lspA show reduced infectivity in guinea pig models, underscoring its role in respiratory and ocular infections .

Applications in Biomedical Research

  • Drug Target Screening: Used to identify inhibitors of lipoprotein processing, a potential therapeutic strategy against chlamydial infections .

  • Antigen Production: Recombinant lspA serves as an immunogen for antibody development, aiding in diagnostic assays .

Comparative Analysis with Orthologs

The C. caviae lspA shares 78% sequence identity with C. trachomatis CT541 but exhibits distinct substrate specificity due to variations in its catalytic pocket . Phylogenetic analysis places it closer to Rhizobium loti homologs, suggesting evolutionary adaptation to host niches .

Challenges and Future Directions

Current limitations include low yield in recombinant expression systems and incomplete structural data. Cryo-EM studies are underway to resolve its membrane-bound conformation . Further work is needed to explore its interaction with host immune pathways during persistent infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CCA_00210; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
lspA
Target Protein Sequence
MSSRSRSTFLAISFFVLIDWVSKLAVLLYRGNLPDARPILYQYSWGKLIFCICPTFNEGA AFGIFSKYKYFLFAIRIAIILGILAFLFLRKKRTSPSIRFSLILLCSGAIGNVGDILFYR HVVDFISIGFKRWYFPTFNFADIFISLGTFIFVYKLYFPTKQKIK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (lspA) and what is its functional role in Chlamydophila caviae?

Lipoprotein Signal Peptidase (lspA) is an essential aspartyl protease that plays a critical role in the lipoprotein-processing pathway in bacteria, including Chlamydophila caviae. Its primary function is to cleave the transmembrane helix signal peptide of lipoproteins after they have been processed by other enzymes in the pathway. This processing step is crucial for proper lipoprotein maturation, which affects bacterial cell envelope integrity, nutrient acquisition, and virulence factors.

In C. caviae, as in other bacterial species, lspA contains a catalytic dyad of aspartate residues that performs the proteolytic cleavage of signal peptides. This enzyme is particularly important because it is essential for viability in Gram-negative bacteria and contributes significantly to virulence in Gram-positive bacteria. The unique conformational dynamics of lspA, particularly the movement of its periplasmic helix, are crucial for its ability to recognize and process a variety of substrates .

C. caviae is primarily known as the causative agent of conjunctivitis in guinea pigs, but has also been associated with community-acquired pneumonia in humans. The proper functioning of lspA is likely critical for C. caviae's pathogenicity, as correctly processed lipoproteins are essential for bacterial cell envelope integrity and host-pathogen interactions .

How does the structure of C. caviae lspA relate to its function?

The structure of C. caviae lspA reflects its specialized function as a membrane-embedded protease. While a C. caviae-specific structure has not been completely characterized, insights from related lspA proteins provide valuable information about structure-function relationships. The enzyme contains multiple transmembrane domains with a critical periplasmic helix (PH) that undergoes significant conformational changes during substrate binding and catalysis.

The functional conformational dynamics of lspA occur on the nanosecond timescale and facilitate an equilibrium between different states that are crucial for enzymatic activity. In the apo (unbound) state, the protein fluctuates between an open conformation required for substrate binding and a closed state that occludes active site residues from the hydrophobic membrane environment. This conformational flexibility is essential for the enzyme's ability to bind diverse lipoprotein substrates while maintaining the specificity of signal peptide cleavage .

The catalytic mechanism involves a dyad of aspartate residues that form the active site. In the closed conformation, these charged residues are protected from the lipid bilayer, preventing unfavorable interactions. When a substrate approaches, the periplasmic helix shifts to a more open conformation, creating a binding pocket that can accommodate the signal peptide. This "clamping" mechanism, formed by the β-cradle and periplasmic helix, positions the substrate correctly for proteolytic cleavage .

What expression systems are most effective for producing recombinant C. caviae lspA?

For successful recombinant expression of C. caviae lspA, researchers should consider the unique challenges presented by membrane proteins. Based on recent advances in Chlamydial genetics and protein expression technologies, the following systems offer distinct advantages:

  • E. coli-based expression systems:

    • BL21(DE3) strains with T7 promoter-based vectors (pET series) can provide good yields

    • C41(DE3) and C43(DE3) strains, specifically engineered for membrane protein expression, may improve solubility and reduce toxicity

    • Lower induction temperatures (16-20°C) and reduced inducer concentrations often improve proper folding

    • Fusion tags such as His6, MBP, or SUMO can enhance solubility and facilitate purification

  • Chlamydial transformation systems:

    • Recently developed shuttle vector-based transformation systems have been successfully applied to C. caviae

    • These vectors typically contain the cryptic plasmid of C. caviae, pUC19 origin of replication, beta-lactamase for selection, and fluorescent protein genes for expression monitoring

    • This approach allows expression in the native cellular environment, potentially preserving authentic folding and post-translational modifications

When expressing lspA, it's essential to consider its membrane-associated nature. The protein contains multiple transmembrane domains and requires a lipid environment for proper folding and function. Detergent selection for extraction and purification is critical, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) often providing the best results for maintaining native structure and activity.

How can the conformational dynamics of C. caviae lspA be effectively studied?

Studying the conformational dynamics of C. caviae lspA requires a multi-technique approach to capture the protein's flexibility and movement essential for its function. Based on successful studies with related lspA proteins, the following methodological approaches are recommended:

  • Molecular Dynamics (MD) Simulations:

    • All-atom MD simulations in explicit lipid bilayers can reveal nanosecond timescale dynamics

    • These simulations should focus on the movement of the periplasmic helix relative to the β-cradle

    • Analysis should quantify the populations of closed, intermediate, and open conformational states

    • Results can guide the design of experimental studies by identifying key residues involved in conformational changes

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling (SDSL) followed by continuous wave (CW) EPR can identify mobility of specific regions

    • Double Electron-Electron Resonance (DEER) measurements can determine distance distributions between strategically placed spin labels

    • This approach has been successfully used to characterize the conformational states of related lspA proteins

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Can identify regions with differential solvent accessibility in different functional states

    • Particularly useful for comparing apo vs. substrate/inhibitor-bound states

    • Provides peptide-level resolution of conformational changes

The conformational dynamics of lspA are critical for understanding its function. Research has shown that in the apo state, the dominant conformation is closed, protecting the charged active site from the lipid bilayer. With substrate or inhibitor bound, the periplasmic helix adopts more open conformations. These conformational changes occur on the nanosecond timescale and represent essential steps in the catalytic cycle .

A hybrid approach combining computational and experimental methods provides the most comprehensive view of lspA dynamics. MD simulations can generate atomistic models of different conformational states, while EPR and other experimental techniques provide validation and can identify states that may be missed in simulations.

What challenges exist in purifying active recombinant C. caviae lspA?

Purification of active recombinant C. caviae lspA presents several challenges due to its membrane-embedded nature and conformational dynamics. Researchers should address the following key considerations:

  • Membrane Extraction and Solubilization:

    • Efficient extraction from membranes requires careful selection of detergents

    • Mild non-ionic detergents (DDM, LMNG) generally preserve activity better than harsh ionic detergents

    • Detergent concentration must be optimized to prevent protein aggregation while maintaining a lipid-like environment

    • Alternative solubilization methods using styrene-maleic acid (SMA) copolymers may preserve native lipid interactions

  • Maintaining Structural Integrity:

    • The conformational flexibility essential for function makes lspA potentially unstable during purification

    • Buffer optimization should include screening different pH values (typically 7.0-8.0), salt concentrations (100-300 mM NaCl), and stabilizing additives (glycerol, specific lipids)

    • Temperature control is critical; all purification steps should be performed at 4°C

    • Inclusion of specific lipids from bacterial membranes may help stabilize native conformations

  • Activity Preservation:

    • The catalytic dyad of aspartate residues can be susceptible to oxidation or other modifications

    • Reducing agents (1-5 mM DTT or TCEP) may be necessary to prevent disulfide formation

    • Protease inhibitors should be included throughout purification to prevent degradation

    • Rapid purification protocols reduce exposure time to potentially damaging conditions

  • Functional Validation:

    • Activity assays should be performed at each purification step to track retention of function

    • FRET-based peptide cleavage assays can provide a sensitive measure of proteolytic activity

    • Thermal stability assays (differential scanning fluorimetry) can assess structural integrity

    • Circular dichroism spectroscopy can confirm proper secondary structure content

The purification strategy should be tailored to the intended downstream applications. For structural studies, higher purity and homogeneity are required, potentially at the expense of yield. For functional assays, maintaining native-like activity may be prioritized over absolute purity. In all cases, proper reconstitution into a membrane-like environment (detergent micelles, nanodiscs, or liposomes) is essential for preserving the natural conformational dynamics of lspA.

How does C. caviae lspA compare to lspA from other bacterial species?

C. caviae lspA shares fundamental features with lspA from other bacterial species but also exhibits important differences that reflect its adaptation to the unique lifestyle of Chlamydial organisms. Comparative analysis reveals several key distinctions:

  • Evolutionary Conservation:

    • C. caviae lspA contains the highly conserved catalytic dyad of aspartate residues found in all lspA enzymes

    • Approximately 14 additional highly conserved residues surround the active site, suggesting functional importance

    • This extensive conservation indicates that resistance mutations in the active site would likely interfere with normal enzyme function, making lspA an attractive antibiotic target

  • Structural Organization:

    • Like other lspA proteins, C. caviae lspA contains multiple transmembrane domains

    • The periplasmic helix appears to be a common feature across species, though its length and flexibility may vary

    • The β-cradle structure that forms part of the substrate binding "clamp" is also conserved

  • Conformational Dynamics:

    • Studies on related lspA proteins have shown that the periplasmic helix fluctuates on the nanosecond timescale

    • These fluctuations create at least three distinct conformational states:

      • Closed: Dominant in the apo state, protecting the active site from the membrane

      • Intermediate: Often observed in inhibitor-bound states

      • Open: Required for substrate binding but may be rarely populated

    • Similar dynamics are likely present in C. caviae lspA, though species-specific differences may exist

  • Inhibitor Binding:

    • Antibiotics like globomycin bind to and inhibit lspA across multiple bacterial species

    • Binding induces conformational changes in the periplasmic helix, stabilizing an intermediate state

    • This mechanism prevents both substrate binding and catalytic activity

    • While the general inhibition mechanism is conserved, species-specific differences in binding affinity may exist

C. caviae, as an obligate intracellular pathogen with a unique developmental cycle, may have evolved specific adaptations in its lspA to process specialized lipoproteins involved in its infectious process. The recent development of transformation systems for C. caviae opens new possibilities for comparative studies to identify these species-specific features and their functional significance .

What methodological approaches can be used to identify potential inhibitors of C. caviae lspA?

Identification of potential inhibitors for C. caviae lspA requires specialized methodological approaches that account for its membrane-associated nature and unique catalytic mechanism. The following comprehensive strategy combines computational and experimental methods:

  • Structure-Based Virtual Screening:

    • Develop homology models of C. caviae lspA based on known structures of related proteins

    • Refine models using molecular dynamics simulations in membrane environments

    • Perform molecular docking of compound libraries targeting:

      • The catalytic site containing the aspartate dyad

      • Allosteric sites that influence the conformational dynamics of the periplasmic helix

      • Substrate binding regions that form the "clamp" mechanism

    • Prioritize compounds that maintain interactions with the target while showing selectivity against human proteases

  • Enzymatic Assay Development:

    • Design fluorogenic peptide substrates based on predicted C. caviae lipoprotein signal sequences

    • Incorporate FRET pairs that report on cleavage through increased fluorescence

    • Optimize assay conditions for:

      • Buffer composition (pH, salt concentration)

      • Detergent type and concentration

      • Substrate concentration

      • Enzyme concentration

    • Validate assays using known inhibitors like globomycin as positive controls

  • Primary Screening Approaches:

    • High-throughput screening of compound libraries using the optimized enzymatic assay

    • Fragment-based screening to identify building blocks that can be elaborated into larger inhibitors

    • Repurposing screens of approved drugs and clinical candidates to identify new uses for existing molecules

  • Secondary Validation Assays:

    • Thermal shift assays to confirm direct binding to the target

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics and thermodynamics

    • Crystallography or cryo-EM to determine binding modes of promising hits

    • Whole-cell assays to confirm antimicrobial activity and cellular penetration

  • Selectivity and Safety Assessment:

    • Counter-screening against human proteases to identify potential off-target effects

    • Testing activity against beneficial microbiota to assess impact on the microbiome

    • Mammalian cell toxicity testing to establish preliminary safety profiles

The development of C. caviae-selective inhibitors would be valuable research tools for studying the role of lspA in pathogenesis. Known inhibitors like globomycin can serve as starting points for design of more selective compounds. The existence of successful transformation systems for C. caviae enables genetic approaches to validate lspA as the target of any identified inhibitors .

How can shuttle vector transformation systems be optimized for studying C. caviae lspA function?

The recently developed shuttle vector transformation systems for C. caviae represent a significant advancement in genetic manipulation capabilities for this organism. Optimizing these systems specifically for studying lspA function requires careful consideration of vector design, expression control, and experimental applications:

  • Vector Design Considerations:

    • Promoter selection is critical; options include:

      • Native lspA promoter for physiological expression levels

      • Inducible promoters (e.g., tetracycline-responsive) for controlled expression

      • Constitutive promoters of varying strengths for different expression levels

    • Fluorescent protein fusion strategies:

      • C-terminal fusions may preserve signal peptide recognition and processing

      • Carefully designed linker sequences can minimize interference with function

      • Selection of appropriate fluorescent proteins (GFP, mNeonGreen, mScarlet) based on experimental needs

  • Genetic Manipulation Strategies:

    • Gene replacement approaches:

      • Homologous recombination to introduce point mutations in catalytic residues

      • Domain swapping with lspA from other species to identify functional regions

      • Introduction of tagged versions for localization and interaction studies

    • Expression modulation:

      • Antisense RNA strategies for knockdown studies

      • Overexpression to study effects of increased lspA activity

      • Complementation of conditionally lethal mutants

  • Functional Analysis Methods:

    • Phenotypic characterization:

      • Growth curve analysis under various stress conditions

      • Morphological assessment using microscopy

      • Antibiotic susceptibility profiling

    • Biochemical evaluation:

      • Monitoring lipoprotein processing efficiency in vivo

      • Quantitative proteomics to identify accumulating unprocessed substrates

      • Membrane integrity assessment

  • Application to Inhibitor Studies:

    • Creation of reporter strains where cell survival or fluorescence intensity correlates with lspA activity

    • Development of high-throughput compatible assays for inhibitor screening in the native cellular context

    • Construction of strains with modified lspA to validate mechanism of action of identified inhibitors

The successful development of transformation systems for C. caviae opens numerous possibilities for studying lspA function in its native context. These systems yield stable transformants over several passages, both in the presence and absence of selective antibiotics, providing reliable platforms for long-term studies . By optimizing these tools for lspA-specific investigations, researchers can gain unprecedented insights into the role of this enzyme in Chlamydial biology and pathogenesis.

How can molecular dynamics simulations be optimized for studying C. caviae lspA in lipid bilayers?

Molecular dynamics (MD) simulations of C. caviae lspA in lipid bilayers require careful consideration of the membrane environment, simulation parameters, and analysis methods to generate meaningful insights into protein dynamics. Based on successful approaches used with related lspA proteins, the following optimized protocol is recommended:

  • System Preparation and Model Building:

    • Homology modeling of C. caviae lspA using known structures of related proteins as templates

    • Multiple template alignment to improve model accuracy, particularly for the critical periplasmic helix region

    • Careful placement in a lipid bilayer that mimics the bacterial inner membrane composition

    • Proper orientation with the active site accessible to the periplasmic space

    • Thorough solvation and ion placement to neutralize the system

  • Simulation Parameters:

    • Force field selection is critical for membrane protein simulations:

      • CHARMM36m with CHARMM36 lipid parameters provides good results for membrane proteins

      • Amber ff14SB with Lipid17 parameters is a viable alternative

    • Multi-stage equilibration protocol:

      • Position restraints on protein backbone during initial equilibration

      • Gradual release of restraints to allow lipid reorganization around protein

      • Final unrestrained equilibration to ensure stability

    • Production simulation requirements:

      • Minimum 500 ns, ideally multiple microseconds for capturing conformational changes

      • Multiple replicate simulations from different starting points

      • Appropriate temperature (310K) and pressure coupling

  • Analysis Framework:

    • Essential dynamics analysis to identify dominant motions:

      • Principal component analysis of the periplasmic helix movement

      • Identification of correlated motions between different protein regions

    • Conformational state characterization:

      • Clustering based on key structural features

      • Distance measurements between the periplasmic helix and β-cradle

      • Analysis of active site accessibility and geometry

    • Integration with experimental data:

      • Comparison with EPR distance measurements

      • Validation against known inhibitor binding modes

      • Prediction of new testable hypotheses

Research on related lspA proteins has shown that the periplasmic helix fluctuates on the nanosecond timescale and samples at least three distinct conformational states: closed (predominant in apo state), intermediate (stabilized by inhibitors), and open (required for substrate binding). MD simulations can capture these transitions and provide atomistic details of the mechanisms involved .

The most closed conformation completely occludes the charged active site residues from the lipid bilayer, providing protection when no substrate is present. The intermediate conformation partially exposes the active site and may represent a pre-binding state. The most open conformation creates a trigonal cavity where lipoprotein substrates can bind in the correct orientation for signal peptide cleavage .

What approaches can be used to determine the in vivo substrates of C. caviae lspA?

Identifying the complete set of in vivo substrates of C. caviae lspA is essential for understanding its role in bacterial physiology and pathogenesis. A comprehensive substrate identification strategy should combine computational prediction, genetic manipulation, and proteomics approaches:

  • Bioinformatic Prediction:

    • Genome-wide scanning for lipoprotein signal sequences using established algorithms:

      • LipoP, PRED-LIPO, and other specialized tools can identify canonical lipoprotein signal peptides

      • Custom parameters may be needed to account for C. caviae-specific sequence features

    • Comparative genomics to identify conserved lipoproteins across Chlamydial species

    • Functional annotation of predicted lipoproteins to identify potential virulence factors

  • Genetic Manipulation Approaches:

    • Utilizing the established transformation system for C. caviae to create:

      • Conditional knockdown strains with reduced lspA expression

      • Point mutants with altered catalytic activity

      • Tagged variants for tracking protein interactions

    • Phenotypic analysis to identify functions affected by lspA manipulation

    • Complementation studies to confirm specificity of observed effects

  • Proteomics Strategies:

    • Comparative proteomics of wild-type vs. lspA-manipulated strains:

      • Subcellular fractionation to isolate membrane proteins

      • Quantitative proteomics (SILAC, TMT) to identify proteins with altered abundance or localization

      • N-terminal peptide enrichment to detect changes in signal peptide processing

    • Activity-based protein profiling using probes that target unprocessed lipoprotein precursors

    • Selective labeling of surface-exposed proteins to identify lipoproteins at the bacterial surface

  • Validation of Candidate Substrates:

    • Direct biochemical confirmation using purified recombinant lspA and synthetic peptides

    • Site-directed mutagenesis of predicted cleavage sites to confirm processing

    • Localization studies using fluorescent protein fusions to monitor effects of lspA manipulation

    • Functional studies to assess the importance of processing for substrate activity

  • Physiological Context Assessment:

    • Evaluation of substrate processing under different growth conditions:

      • Various nutrient availabilities

      • Different stages of the developmental cycle

      • Stress conditions mimicking host environments

    • Infection models to assess the impact of substrate processing on virulence

By integrating these approaches, researchers can build a comprehensive map of C. caviae lspA substrates and their functional roles. This information will provide insights into the basic biology of Chlamydial organisms and may identify potential targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.