Recombinant Chlamydophila caviae Na (+)-translocating NADH-quinone reductase subunit C (nqrC)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nqrC; CCA_00364; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
nqrC
Target Protein Sequence
MSSEKPKPHLNKTWYVILFIFALSLFSSVFLSTVYYILAPFEERAAIFDRDQQMLTAAHV
LDFSGKFQIYEEGSWQPAVYDKKSHLLKVADQHAPVVTSSVLDAYTQGFVRPLLADKLGQ
MFSFEEKNINVTEFIEKHQNGHFYQQPLLLFYVILANTEQARAMSAADVIKNPSVVRAII
IPISGFGLWGPIYGYLAVENNGDTVLGTAWYQQAETPGLGANIANPQWQKQFYGKKIFLQ
AAAGNTDFATTPLGLEVIKGSVQSAFGTTPKALSSIDGISGATLTCNGVTEAYAQSLAPY
RNLLISFAKLNQRDHNGSK
Uniprot No.
Target Background
Function
The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol. This process is coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
KEGG: cca:CCA_00364
STRING: 227941.CCA00364
Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
