Recombinant Chlamydophila caviae Na (+)-translocating NADH-quinone reductase subunit D (nqrD)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Expression system:

  • Produced in Escherichia coli, enabling high-yield recombinant protein synthesis .

  • Advantages over native purification: Eliminates contamination risks (e.g., host-derived proteases) and ensures batch-to-batch consistency .

Role in Na(+)-NQR complex:

  • Catalyzes electron transfer from NADH to quinone, generating a sodium gradient used for ATP synthesis and nutrient uptake .

  • Essential for C. caviae’s survival in guinea pigs, where it causes conjunctivitis and respiratory infections .

Genomic variability:

  • The rrn-nqrF region housing nqrD exhibits species-specific modifications:

    OrganismIntergenic Segment Length (bp)Functional Implications
    C. caviae GPIC4,463Intact nqrD; frameshifted ilp
    C. pneumoniae AR392,047Conserved nqrD; disrupted ilp
    C. trachomatis D518Absent nqrD; truncated ilp

This variability suggests evolutionary adaptations to host niches, influencing pathogenicity .

Applications in Research

Antigenic studies:

  • Used in ELISA kits to detect C. caviae infections in guinea pigs, with 98.8% nucleotide identity to clinical isolates .

  • Key target for vaccine development due to surface exposure in the Na(+)-NQR complex .

Drug discovery:

  • The Na(+)-NQR complex is absent in humans, making nqrD a potential antimicrobial target .

  • Inhibitors of Na(+)-NQR (e.g., korormicin) show bactericidal effects in vitro .

Epidemiological Relevance

  • C. caviae prevalence in guinea pigs:

    RegionPositivity RateSample Type
    Switzerland2.7%Conjunctival/rectal
    Netherlands8.9%Composite conjunctival
    Clinical strains share 100% ompA gene identity with zoonotic isolates, highlighting its public health relevance .

Key Challenges and Future Directions

  • Structural resolution: No crystal structure exists for nqrD, limiting mechanistic insights .

  • Expression optimization: Low yields in E. coli necessitate codon optimization or alternative hosts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
nqrD; CCA_00363; Na(+-translocating NADH-quinone reductase subunit D; Na(+-NQR subunit D; Na(+-translocating NQR subunit D; NQR complex subunit D; NQR-1 subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
nqrD
Target Protein Sequence
MAANKSYKSYFLDPLWGNNQPLIAILGICSALAVTTTVNTAITMGLAVSFVTGCSSFFVS LLRKATPDSVRMITQLIIISLFVIVIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRAES LARNVPPIPAFLDGLASGLGYGWVLVTVSIVREFFGFGTILGLQLIPKCFYASETHPDGY ENFGLMVLAPSAFFLLGIMIWGVNILRSKKAKR
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nqrD in Chlamydophila caviae?

The complete genome sequence of Chlamydophila caviae (formerly Chlamydia psittaci GPIC isolate) contains 1,009 annotated genes . While specific information on nqrD in C. caviae is limited in the literature, we can infer from studies of other bacterial systems that nqrD would likely be part of an operon structure. In bacteria like Vibrio cholerae, NQR is a six-subunit membrane protein complex encoded by consecutive structural nqrABCDEF genes . Researchers should examine the C. caviae genome (GenBank accession number AE015925 for chromosome and AE015926 for plasmid) to identify and characterize the nqrD locus and its genetic neighborhood .

How does NqrD function within the NQR complex?

NqrD functions as a critical membrane-bound subunit of the NQR complex. Based on studies in other bacterial systems, NqrD works alongside NqrE to ligate an Fe center within the membrane portion of the complex . This Fe center is integral to the electron transport chain that couples NADH oxidation to ubiquinone reduction while simultaneously translocating Na+ ions across the membrane. The electron transfer pathway likely involves multiple redox centers, including the FAD and 2Fe-2S cluster in NqrF and the covalently attached FMN molecules in NqrB and NqrC . Understanding this electron transport chain is essential for researchers studying energy metabolism in C. caviae.

Why is C. caviae an important model organism for studying chlamydial proteins?

C. caviae serves as a valuable model organism because it represents the fourth species with a complete genome sequence from the Chlamydiaceae family of obligate intracellular bacterial pathogens . It shares 798 conserved genes with all other sequenced Chlamydiaceae genomes, making it representative of core chlamydial functions . C. caviae is a natural pathogen of guinea pigs, causing inclusion conjunctivitis and respiratory infections, and has been extensively used to model sexual transmission and genital tract pathology . Despite being genetically more distant from human pathogens like C. trachomatis, it provides essential comparative insights, as noted in the literature: "With most genes observed in the other chlamydial genomes represented, C. caviae provides a good model for the Chlamydiaceae" .

What expression systems are optimal for recombinant C. caviae NqrD production?

When selecting an expression system for recombinant C. caviae NqrD, researchers should consider that NqrD is a membrane protein with specific folding requirements. E. coli expression systems may be suitable for initial studies, but membrane protein expression often requires specialized strains with modified membrane compositions or chaperone systems. For functional studies, researchers might consider using expression systems that can properly insert the protein into membranes and provide necessary cofactors. If studying the complete NQR complex, co-expression of all six subunits (NqrA-F) may be necessary since proper assembly of the Fe center in NqrD requires interaction with NqrE . Expression conditions should be optimized to balance protein yield with proper folding and insertion into membranes.

What purification strategies maintain the structural integrity of NqrD?

Purifying membrane proteins like NqrD presents unique challenges. Researchers should employ gentle detergent solubilization methods that maintain protein structure while extracting it from membranes. Detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve membrane protein integrity. Affinity chromatography using histidine or other fusion tags can facilitate initial purification, followed by size exclusion chromatography to ensure homogeneity. Throughout purification, it's critical to monitor protein folding using techniques like circular dichroism or fluorescence spectroscopy. For functional studies, researchers should consider reconstituting purified NqrD into liposomes or nanodiscs to provide a native-like membrane environment. The presence of the Fe center in NqrD should be verified using spectroscopic methods similar to those used for studying the Fe centers in other NQR complexes .

How can researchers verify the functional activity of recombinant NqrD?

Verifying functional activity of recombinant NqrD requires multiple approaches. First, spectroscopic analysis can confirm proper incorporation of the Fe center, which is essential for electron transport. Second, researchers should measure electron transfer activities using appropriate electron donors and acceptors in reconstituted systems. Third, sodium transport assays using ion-selective electrodes or fluorescent indicators can assess if the recombinant protein maintains ion translocation capability. For comprehensive assessment, researchers should reconstitute the complete NQR complex (NqrA-F) and measure NADH:ubiquinone oxidoreductase activity coupled with Na+ translocation. Comparative studies with known NQR inhibitors can further validate functional integrity. When interpreting results, researchers should remember that NQR influences iron metabolism in some bacteria, suggesting a potential link between iron homeostasis and NQR function that might be explored in C. caviae .

What PCR and cloning strategies are recommended for nqrD amplification from C. caviae?

For amplifying the nqrD gene from C. caviae, researchers should design primers based on the annotated genome sequence (GenBank accession number AE015925) . When designing PCR amplification strategies, consider the following approach: First, extract genomic DNA from C. caviae using standard protocols for Gram-negative bacteria. For PCR amplification, use high-fidelity DNA polymerases with proofreading capability to minimize errors. Design primers that include appropriate restriction sites for subsequent cloning, considering the removal of any signal sequences if present. Since membrane proteins often contain hydrophobic regions that can complicate PCR, optimization of reaction conditions (including DMSO or specialized buffers) may be necessary. For cloning, consider vectors designed for membrane protein expression that include appropriate fusion tags to aid in purification and detection. Verify cloned sequences thoroughly, as PCR errors in membrane proteins can significantly impact folding and function.

How should researchers analyze protein-protein interactions between NqrD and other NQR subunits?

Analyzing protein-protein interactions between NqrD and other NQR subunits requires specialized approaches for membrane proteins. Cross-linking studies using bifunctional reagents can capture interactions within the assembled complex. Co-immunoprecipitation experiments using antibodies against one subunit can identify interacting partners. For more detailed analysis, researchers could employ techniques like biolayer interferometry or surface plasmon resonance using detergent-solubilized or nanodisc-reconstituted proteins. Hydrogen-deuterium exchange mass spectrometry can identify regions involved in subunit interactions by measuring changes in solvent accessibility. Additionally, researchers could employ bacterial two-hybrid systems adapted for membrane proteins to screen for interactions in vivo. When interpreting results, consider that NqrD and NqrE together ligate an Fe center within the membrane part of the NQR complex, suggesting a particularly strong interaction between these subunits .

What structural biology techniques are most suitable for elucidating NqrD structure?

Determining the structure of membrane proteins like NqrD presents significant challenges. X-ray crystallography remains powerful but requires stable, well-diffracting crystals, which are notoriously difficult to obtain for membrane proteins. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and may be particularly suitable for the entire NQR complex, potentially revealing NqrD's position and interactions. For studying NqrD in isolation, solution NMR could be employed for smaller soluble domains, while solid-state NMR might be suitable for the membrane-embedded regions. Researchers should also consider computational approaches like homology modeling based on structures of related proteins from other bacteria. Integrating low-resolution structural data from techniques like small-angle X-ray scattering with computational modeling can provide valuable structural insights while waiting for high-resolution structures.

How can researchers distinguish between NqrD functional roles and artifacts in experimental systems?

Distinguishing genuine NqrD functions from experimental artifacts requires rigorous controls and complementary approaches. First, include both positive and negative controls in all assays, such as known functional NqrD proteins from related organisms and non-functional mutants. Second, verify results using multiple independent experimental approaches - for example, if electron transfer activity is detected biochemically, confirm it using spectroscopic methods. Third, perform reconstitution experiments with defined components to rule out contributions from contaminating proteins. Fourth, validate in vitro observations with in vivo studies when possible, such as complementation of nqrD mutants. Finally, researchers should remember that membrane proteins are particularly sensitive to their lipid environment, so variations in detergent or lipid composition can significantly affect activity. When interpreting results, consider the multifunctional nature of respiratory complexes, including NQR's reported influence on iron metabolism as a potential secondary function .

How should researchers address challenges in interpreting contradictory results from different experimental approaches?

When faced with contradictory results from different experimental approaches, researchers should implement a systematic troubleshooting strategy. First, carefully review experimental conditions to identify variables that might explain discrepancies, such as buffer composition, detergent choice, or protein concentration. Second, evaluate the sensitivity and specificity of each assay, recognizing that different methods may detect different aspects of protein function. Third, consider whether post-translational modifications or cofactor incorporation differs between experimental systems. Fourth, investigate the possibility of protein heterogeneity or alternative conformational states affecting different assays differently. Fifth, perform additional experiments specifically designed to resolve contradictions, potentially incorporating new methodologies. When reporting contradictory results, researchers should transparently present all data and propose testable hypotheses that might explain the discrepancies, rather than selectively presenting data that fits preconceived notions.

How might NqrD function relate to C. caviae pathogenesis and host interaction?

The relationship between NqrD function and C. caviae pathogenesis remains to be fully elucidated. As a component of the respiratory chain, NqrD likely contributes to energy metabolism during infection. Researchers investigating this connection should consider several approaches. First, examine whether nqrD expression changes during different stages of the C. caviae developmental cycle or in response to host cell conditions, similar to how plasmid-responsive chromosomal loci respond to glucose limitation . Second, determine whether disruption of nqrD affects important virulence properties like inclusion formation, metabolite acquisition, or stress resistance. Third, investigate whether NQR activity influences C. caviae interactions with host cell signaling pathways, similar to how plasmid status affects TLR2 signaling . Fourth, examine potential connections between respiratory function and virulence-associated metabolic adaptations. Understanding these relationships may reveal whether NQR components like NqrD represent potential therapeutic targets for chlamydial infections.

What is the relationship between NqrD function and iron metabolism in Chlamydophila caviae?

The relationship between NqrD function and iron metabolism in C. caviae warrants investigation based on findings in other bacteria showing that NQR influences iron metabolism . Researchers should explore this connection through several approaches. First, analyze iron-dependent regulation of nqrD expression using quantitative PCR under varying iron concentrations, similar to the RT-PCR methods used for studying plasmid-responsive genes in C. caviae . Second, determine whether disruption of nqrD affects iron uptake, storage, or utilization. Third, investigate whether iron limitation alters NQR complex assembly or activity. Fourth, examine potential physical or functional interactions between NQR components and iron transport or storage proteins. Understanding this relationship could provide insights into how C. caviae adapts to iron-limited environments during infection and might reveal whether the NQR complex represents a potential drug target, as suggested for other bacteria .

How conserved is nqrD across the Chlamydiaceae family?

Analyzing nqrD conservation across the Chlamydiaceae family can provide insights into its evolutionary importance. Researchers should conduct comprehensive comparative genomic analyses similar to those performed for other C. caviae genes, using BLASTP with appropriate E-value cutoffs (10⁻¹⁵) . Position effect analysis can determine whether gene order surrounding nqrD is conserved, which might indicate functional constraints or operon structures . Calculate BLAST score ratio (BSR) values to quantify protein similarity across species, as done for other C. caviae proteins (Figure 1 in reference ). When interpreting conservation patterns, consider the phylogenetic relationships among Chlamydiaceae - C. caviae proteins are generally more similar to those in C. pneumoniae than to C. trachomatis or C. muridarum . Also examine whether nqrD falls into the category of core genes conserved across all Chlamydiaceae (approximately 798 genes in C. caviae) or represents a more specialized adaptation .

SpeciesGenome size (nt)GC (%)Total ORFsConservation level
C. caviae1,173,39039.21009-
C. muridarum1,072,95040.3921Moderate similarity
C. trachomatis (serovar D)1,042,51941.3894Moderate similarity
C. pneumoniae (AR39)1,229,85840.61130Higher similarity

Table 1: Genomic characteristics of sequenced Chlamydiaceae species for comparative analysis .

What can be learned from comparing C. caviae NqrD with homologs in other bacterial pathogens?

Comparing C. caviae NqrD with homologs in other bacterial pathogens can reveal adaptations specific to different ecological niches and pathogenic lifestyles. Researchers should conduct detailed sequence alignments to identify conserved functional domains and species-specific variations. Particular attention should be paid to residues involved in cofactor binding, subunit interactions, and ion translocation. Comparative structural modeling can predict three-dimensional differences that might reflect functional adaptations. Researchers should also analyze expression patterns and genetic context across species to identify regulatory differences. When interpreting these comparisons, consider that NQR has been implicated in iron metabolism in some bacteria, suggesting possible convergent or divergent evolution of secondary functions . These comparative analyses may reveal whether NqrD has evolved unique features in obligate intracellular pathogens like C. caviae compared to free-living bacterial pathogens.

How might horizontal gene transfer have influenced nqrD evolution in Chlamydiaceae?

Investigating potential horizontal gene transfer (HGT) of nqrD in Chlamydiaceae requires careful phylogenetic analysis. While no direct evidence for nqrD HGT is presented in the search results, the phenomenon has been observed for other genes in Chlamydiaceae. For example, one gene cluster (guaBA-add) in the replication termination region of C. caviae is much more similar to orthologs in C. muridarum than to those in the phylogenetically closest species C. pneumoniae, suggesting possible horizontal transfer between rodent-associated Chlamydiae . To investigate whether nqrD shows similar patterns, researchers should construct phylogenetic trees based on nqrD sequences and compare them with species trees based on conserved housekeeping genes. Discordance between these trees might indicate HGT events. Additionally, analyze nucleotide composition, codon usage patterns, and flanking mobile genetic elements that might suggest foreign origin. These analyses could reveal whether nqrD evolution in Chlamydiaceae has been driven primarily by vertical inheritance or has been influenced by horizontal acquisition from other bacterial sources.

What gene editing approaches are most promising for studying nqrD function in C. caviae?

Genetic manipulation of obligate intracellular pathogens like C. caviae presents unique challenges. Based on successful approaches with other Chlamydiaceae genes, researchers should consider several strategies. Chemical mutagenesis with agents like novobiocin has successfully generated plasmid-cured C. caviae strains (strain CC13) and could potentially create nqrD point mutations . For targeted genetic manipulation, recently developed transformation systems for Chlamydiaceae could be adapted for C. caviae, potentially allowing for gene knockouts, fluorescent protein tagging, or controlled expression systems. When designing genetic modifications, researchers should employ similar validation approaches as used for plasmid-cured C. caviae strains, including PCR verification, Southern hybridization, and phenotypic characterization through plaque assays and growth curves . Future developments might include CRISPR-Cas9 systems optimized for Chlamydiaceae, which would enable more precise genetic manipulations to study nqrD function.

How might insights from C. caviae NqrD research contribute to antimicrobial development?

Research on C. caviae NqrD could contribute to antimicrobial development through several avenues. First, given that NQR influences iron metabolism in some bacteria, making it "a potential drug target for antibiotics" , understanding its structure and function in Chlamydiaceae could reveal unique features that might be exploited for selective inhibition. Second, comparative studies between human pathogens like C. pneumoniae and the guinea pig pathogen C. caviae could identify conserved features that represent broadly applicable drug targets. Third, since energy generation is critical for bacterial survival, compounds that selectively disrupt NQR function might effectively inhibit chlamydial growth. When evaluating potential inhibitors, researchers should test specificity, efficacy against multiple Chlamydiaceae species, and effects on host cells. This research would complement current antimicrobial approaches and potentially address the need for new therapeutics against intrinsically resistant or persistent chlamydial infections.

What emerging technologies might advance understanding of NqrD structure and function?

Several emerging technologies could significantly advance understanding of NqrD structure and function. Cryo-electron microscopy, which has revolutionized membrane protein structural biology, could reveal the architecture of the entire NQR complex and NqrD's position within it at near-atomic resolution. Single-molecule fluorescence techniques could provide insights into conformational changes during the catalytic cycle. Advanced mass spectrometry methods like hydrogen-deuterium exchange or cross-linking mass spectrometry could map protein-protein interactions within the complex. For functional studies, newly developed fluorescent probes for membrane potential and ion fluxes could allow real-time monitoring of NQR activity in living cells. Synthetic biology approaches could enable construction of minimal NQR systems with defined components to dissect individual contributions of each subunit. Computational approaches, including molecular dynamics simulations and machine learning-based structure prediction, will continue to improve our ability to model membrane protein dynamics and interactions even in the absence of experimental structures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.