Recombinant Chlamydophila caviae Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chlamydophila caviae nqrE

Recombinant nqrE is a 264-amino acid protein (UniProt ID: Q823P5) expressed in Escherichia coli with an N-terminal His tag for purification . It is a subunit of the Na⁺-translocating NADH-quinone reductase (Na⁺-NQR), a membrane-bound enzyme complex responsible for coupling electron transfer from NADH to quinone with sodium ion translocation across bacterial membranes . This enzyme is pivotal in generating a sodium motive force (smf) for cellular processes in Chlamydophila caviae, a pathogen linked to guinea pig infections and zoonotic pneumonia in humans .

Key Features

PropertyDetails
SpeciesChlamydophila caviae (strain GPIC)
Amino Acid Range1–264
TagN-terminal His tag (determined during production)
Molecular FunctionSodium-pumping NADH:quinone oxidoreductase activity (EC 1.6.5.-)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Active Site Residues

The glutamate residue at position 95 (E95) in nqrE is essential for sodium translocation. Mutagenesis studies show that substitutions (e.g., E95D, E95A) disrupt Na⁺-dependent enzyme kinetics and impair membrane potential generation . Electrochemical analyses confirm that E95 mutations abolish the Na⁺-dependent redox modulation of flavin mononucleotide (FMN) cofactors, indicating its role in cation coupling .

Expression and Purification

The recombinant nqrE is produced in E. coli using codon-optimized vectors. Purification involves affinity chromatography via the His tag, yielding >90% purity . Stability is enhanced in glycerol-containing buffers, though repeated freeze-thaw cycles are discouraged .

Expression Parameters

ParameterDetails
HostEscherichia coli
VectorpET-based system
Yield50 µg per batch (scalable)

Role in Na⁺-NQR Enzyme Complex

The Na⁺-NQR complex (subunits A–F) couples NADH oxidation to sodium extrusion. Subunit E (nqrE) anchors the complex to the membrane and participates in quinone reduction . Cryo-EM structures of homologous complexes (e.g., Vibrio cholerae Na⁺-NQR) reveal that nqrE interacts with NqrB and NqrD to form a sodium channel .

Mechanistic Insights

  • Electron Transfer Pathway: Electrons flow from NADH → FAD (NqrF) → FMN (NqrC) → riboflavin (NqrB) → quinone .

  • Sodium Translocation: Conformational changes in nqrE facilitate Na⁺ movement across the membrane, driven by redox reactions .

Antibiotic Development

Na⁺-NQR is a target for inhibitors like korormicin and aurachin, which block quinone binding in the NqrB-NqrE interface . Recombinant nqrE enables structural studies to design species-specific antimicrobials .

Pathogenicity Studies

C. caviae infections in guinea pigs model human chlamydial diseases . Recombinant nqrE aids in dissecting the bacterium’s energy metabolism and virulence .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing of the protein is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during the production process. If you have a specific tag type preference, please communicate this to us, and we will prioritize development with the specified tag whenever feasible.
Synonyms
nqrE; CCA_00362; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
nqrE
Target Protein Sequence
MWLGEYTWLNVFGIFLQATFIQNILLSNFLGMCSYLACSARVSTANGLGMSVALVLTVTG SINWVVHTFITGPKALTWISPSLANVNLNFLELIIFIVVIAAFTQILELLLEKVSRNLYL SLGIFLPLIAVNCAILGGVLFGITRNYPFIPMMIFSLGAGCGWWLAIVLFATIKEKLAYS DIPKNLQGMGISFITTGLIAMAFMSLTGIDISKPSAAAPTSDILETPNASSITTTNLKPV KKVRIAQQRAAKEKAINIKRGKTQ
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase (Na+-NQR) complex in Chlamydophila caviae?

The Na(+)-translocating NADH-quinone reductase (Na+-NQR) complex in Chlamydophila caviae is a membrane protein complex that couples NADH oxidation to sodium ion translocation across the bacterial membrane. Similar to the Na+-NQR studied in Vibrio cholerae, this complex catalyzes the reduction of ubiquinone to ubiquinol through two successive reactions, simultaneously transporting Na+ ions from the cytoplasm to the periplasm . The complex consists of six subunits (NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF), each with specific roles in the electron transfer and ion translocation processes. The NqrE subunit, along with the other subunits, is involved in the second step of the reaction, specifically the conversion of ubisemiquinone to ubiquinol .

What is the genomic context of nqrE in Chlamydophila caviae?

The nqrE gene is part of the Chlamydophila caviae genome, which consists of 1,173,390 nucleotides with an additional plasmid of 7,966 nucleotides . The complete genome sequence of C. caviae, formerly known as Chlamydia psittaci GPIC isolate, has been determined and represents the fourth species with a complete genome sequence from the Chlamydiaceae family of obligate intracellular bacterial pathogens . The genome contains 1,009 annotated genes, of which 798 are conserved across all completed Chlamydiaceae genomes. The genomic context of nqrE should be considered in relation to the 68 unique genes that lack orthologs in other completed chlamydial genomes, which include determinants for tryptophan and thiamine biosynthesis and a ribose-phosphate pyrophosphokinase (prsA gene) .

How does the structure of NqrE contribute to the function of the Na+-NQR complex?

The NqrE subunit, as part of the Na+-NQR complex, contributes to the protein architecture that facilitates electron transfer and ion translocation. Based on studies of similar Na+-NQR complexes such as that in Vibrio cholerae, the complex contains a unique set of cofactors that shuttle electrons from NADH across the membrane to quinone . These cofactors include one flavin adenine dinucleotide (FAD), two covalently bound flavin mononucleotides (FMNs), one riboflavin, and two iron-sulfur centers . While the search results don't provide specific structural details for NqrE from C. caviae, research on V. cholerae suggests that ion pumping in Na+-NQR is driven by large conformational changes that couple electron transfer to ion translocation . NqrE likely participates in this mechanism, working in concert with the other subunits to facilitate the second step of ubiquinone reduction.

What are the optimal conditions for recombinant expression of C. caviae nqrE in E. coli?

For optimal recombinant expression of C. caviae nqrE in E. coli, researchers should consider the following methodological approach based on standard protein expression protocols and specific considerations for membrane proteins:

  • Vector Selection: Choose an expression vector with an appropriate promoter (such as T7 or tac) and include fusion tags (His-tag, GST, etc.) to aid in purification.

  • E. coli Strain Selection: BL21(DE3) or its derivatives are commonly used for membrane protein expression. C41(DE3) and C43(DE3) strains, which are specifically designed for membrane protein expression, may provide better results.

  • Expression Conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction: Use lower IPTG concentrations (0.1-0.5 mM)

    • Growth media: Rich media such as TB or 2xYT supplemented with appropriate antibiotics

    • Duration: Extended expression time (16-24 hours) at lower temperatures

  • Optimization Parameters: The following table outlines parameters to optimize for successful expression:

ParameterRange to TestConsiderations
Temperature16-30°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-1.0 mMLower concentrations may improve proper folding
Expression time4-24 hoursBalance between yield and potential degradation
MediaLB, TB, 2xYTRicher media may support higher yields
OD600 at induction0.6-1.0Cell density affects expression efficiency

These recommendations are based on general principles for membrane protein expression and must be empirically optimized for the specific nqrE protein from C. caviae.

What purification strategies are most effective for isolating recombinant NqrE while maintaining its native conformation?

The most effective purification strategies for isolating recombinant NqrE while maintaining its native conformation should address the challenges associated with membrane protein purification:

  • Membrane Extraction: Use mild detergents to solubilize the membrane fraction. Common detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Digitonin

    • CHAPS

  • Affinity Chromatography: Utilize the fusion tag (typically His-tag) for initial purification.

    • Immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins

    • Optimize imidazole concentrations in wash and elution buffers to reduce non-specific binding

  • Size Exclusion Chromatography: Apply as a polishing step to separate different oligomeric states and remove aggregates.

  • Buffer Optimization: Include stabilizing components in all buffers:

    • Glycerol (10-20%)

    • Salt (150-300 mM NaCl)

    • Maintain detergent concentration above critical micelle concentration (CMC)

    • Consider adding lipids to stabilize the protein

  • Quality Control: Assessment of protein purity and conformational integrity:

    • SDS-PAGE to confirm molecular weight and purity

    • Western blot for identity confirmation

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Activity assays to confirm functional integrity

When developing a purification protocol, it's essential to maintain conditions that preserve the native conformation, especially considering that NqrE is part of a complex that contains multiple cofactors and participates in electron transfer processes .

How can researchers assemble a functional recombinant Na+-NQR complex containing NqrE for in vitro studies?

To assemble a functional recombinant Na+-NQR complex containing NqrE for in vitro studies, researchers should consider:

  • Co-expression Strategy: Express all six subunits (NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF) simultaneously in E. coli.

    • Use a polycistronic expression vector or co-transform multiple compatible plasmids

    • Ensure proper stoichiometry by adjusting promoter strengths or ribosome binding sites

  • Sequential Purification Approach:

    • Tag only one subunit (e.g., His-tag on NqrE) to pull down the entire complex

    • Alternatively, use orthogonal tagging (different tags on different subunits) for verification of complete assembly

  • Cofactor Incorporation:

    • Supplement growth media with riboflavin, FMN, and FAD precursors

    • Add iron salts to support iron-sulfur cluster formation

    • Consider in vitro reconstitution of cofactors post-purification

  • Reconstitution into Liposomes:

    • Prepare liposomes with E. coli lipid extracts or defined lipid mixtures

    • Use detergent removal methods (dialysis, Bio-Beads, etc.) to incorporate the complex

  • Functional Validation:

    • NADH oxidation assays (spectrophotometric monitoring at 340 nm)

    • Quinone reduction assays

    • Na+ transport assays using fluorescent indicators or radioisotope methods

    • Electron transfer kinetics using stopped-flow techniques

Based on studies of Na+-NQR from V. cholerae, the complex requires specific cofactors to shuttle electrons from NADH across the membrane . Ensuring proper incorporation of these cofactors (FAD, FMNs, riboflavin, and iron-sulfur centers) will be critical for obtaining a functional complex.

What methods are most reliable for assessing the ion translocation activity of recombinant NqrE within the Na+-NQR complex?

Several methods can be employed to reliably assess the ion translocation activity of recombinant NqrE within the Na+-NQR complex:

  • Proteoliposome-based Assays:

    • Na+ Transport Measurement:

      • Using Na+-sensitive fluorescent dyes (SBFI, CoroNa Green)

      • 22Na+ radioisotope uptake experiments

      • Na+ electrode-based measurements outside proteoliposomes

  • Electrophysiological Methods:

    • Solid-supported Membrane Electrophysiology: Adsorb proteoliposomes onto a planar membrane and measure capacitive currents upon substrate addition

    • Patch-clamp Analysis: If the complex can be reconstituted into giant unilamellar vesicles

  • Coupled Enzyme Assays:

    • Measure NADH oxidation (decrease in absorbance at 340 nm) coupled to Na+ transport

    • Assess the effect of Na+ concentration on enzymatic activity

    • Test inhibitors specific to Na+ transport

  • Structure-Function Analysis:

    • Site-directed mutagenesis of conserved residues in NqrE

    • Analysis of how mutations affect both electron transfer and ion translocation

Based on research with V. cholerae Na+-NQR, ion pumping is driven by large conformational changes that couple electron transfer to ion translocation . The redox state of a unique intramembranous [2Fe-2S] cluster orchestrates the movements of subunit NqrC, which acts as an electron transfer switch . Similar mechanisms might be involved in C. caviae Na+-NQR, and researchers should design experiments to investigate if NqrE participates in this conformational coupling.

How can researchers determine the specific role of NqrE in the electron transfer pathway of the Na+-NQR complex?

To determine the specific role of NqrE in the electron transfer pathway of the Na+-NQR complex, researchers should employ a multi-faceted experimental approach:

  • Redox Potential Measurements:

    • Determine the midpoint potentials of redox centers in NqrE using spectroelectrochemical methods

    • Compare with potentials of other subunits to establish the electron transfer sequence

  • Rapid Kinetics Analysis:

    • Use stopped-flow spectroscopy to measure electron transfer rates between subunits

    • Apply flash photolysis techniques to trigger electron transfer and monitor the process

  • EPR Spectroscopy:

    • Identify paramagnetic intermediates in the electron transfer pathway

    • Use distance measurements between paramagnetic centers to map the pathway

  • Subunit Interaction Studies:

    • Crosslinking experiments to determine proximity of NqrE to other subunits

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding affinities

  • Computational Approaches:

    • Molecular dynamics simulations to predict electron transfer pathways

    • Quantum mechanical calculations to estimate electron transfer rates

In V. cholerae Na+-NQR, electrons shuttle from NADH twice across the membrane to quinone . Understanding where NqrE fits in this pathway requires mapping the physical arrangement of redox centers and their sequential reduction/oxidation during catalysis. The experimental approaches above would help establish whether NqrE contains redox-active cofactors, interacts directly with quinones, or plays a structural role supporting other electron-transferring subunits.

What are the best experimental designs for studying the interaction between NqrE and other subunits in the Na+-NQR complex?

The best experimental designs for studying interactions between NqrE and other subunits in the Na+-NQR complex include:

  • Co-Immunoprecipitation (Co-IP):

    • Generate antibodies against NqrE or use tagged versions

    • Pull down NqrE and identify interacting partners by mass spectrometry

    • Perform reciprocal Co-IPs with antibodies against other subunits

  • Crosslinking Studies:

    • Chemical crosslinking with variable-length crosslinkers to map distances

    • Photo-crosslinking with site-specifically incorporated photoactive amino acids

    • Analysis of crosslinked products by mass spectrometry to identify interaction interfaces

  • FRET/BRET Analysis:

    • Label NqrE and potential partner subunits with fluorescent/bioluminescent tags

    • Measure energy transfer efficiency to determine proximity and orientation

    • Perform distance measurements under various substrate/inhibitor conditions

  • Split Reporter Assays:

    • Bacterial two-hybrid systems using split adenylate cyclase

    • Split GFP or luciferase complementation assays

    • These can be performed in the native membrane environment

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare HDX patterns of individual subunits versus assembled complex

    • Identify regions that become protected upon complex formation

    • Map conformational changes induced by substrate binding or redox state changes

  • Structural Studies:

    • Cryo-EM analysis of the entire complex

    • X-ray crystallography of subcomplexes

    • NMR studies of specific interfaces

Based on studies with V. cholerae Na+-NQR, large conformational changes couple electron transfer to ion translocation . Determining how NqrE participates in these conformational changes and identifying its interaction partners within the complex will help elucidate its specific role in the mechanism.

How does the sequence and structure of C. caviae NqrE compare to homologous proteins in other bacterial species, and what implications does this have for function?

Comparative analysis of C. caviae NqrE with homologous proteins reveals important evolutionary and functional implications:

  • Sequence Conservation:
    While the search results don't provide specific sequence alignments for NqrE, we can infer from the genome analysis of C. caviae that there are both conserved and unique features compared to other Chlamydiaceae . Of the 1,009 annotated genes in C. caviae, 798 are conserved across all other completed Chlamydiaceae genomes . NqrE would be part of this conservation analysis, potentially showing specific adaptations in C. caviae.

  • Structural Comparison Table:

SpeciesNqrE Size (aa)Key Structural FeaturesFunctional Implications
C. caviaeUnknown from dataLikely membrane-spanning domainsNa+ binding and translocation
V. choleraeKnown from literatureMultiple transmembrane helices, cofactor binding sitesWell-characterized Na+ pump function
Other ChlamydiaceaeVariableDegree of conservation unknown from dataPotential differences in ion specificity
  • Functional Divergence:
    The Na+-NQR complex in V. cholerae generates a sodium gradient via a mechanism involving large conformational changes that couple electron transfer to ion translocation . The structure and function of NqrE in C. caviae may have evolved specific adaptations related to its intracellular lifestyle, potentially involving different ion specificities or regulatory mechanisms.

  • Phylogenetic Context:
    The genome of C. caviae shows evidence of horizontal gene transfer, particularly in the replication termination region (RTR), which includes gene clusters more similar to orthologs in C. muridarum than to those in the phylogenetically closest species C. pneumoniae . This suggests that some functional complexes, potentially including Na+-NQR components, might have evolved via horizontal gene transfer events between different Chlamydia species.

Understanding these evolutionary relationships provides insights into the adaptation of the Na+-NQR complex to different bacterial environments and may reveal species-specific functional adaptations in the C. caviae NqrE protein.

What role does the Na+-NQR complex play in the pathogenesis and survival of Chlamydophila caviae, and how might targeting NqrE affect bacterial viability?

The role of the Na+-NQR complex in C. caviae pathogenesis and survival, particularly focusing on NqrE as a potential target, involves several key aspects:

  • Energy Metabolism in Intracellular Pathogens:
    As an obligate intracellular pathogen, C. caviae has specific adaptations for energy acquisition within host cells . The Na+-NQR complex, by generating a sodium gradient across the membrane, provides a mechanism for energy conservation that may be essential during certain stages of the developmental cycle. This is particularly important considering that Chlamydiaceae have streamlined genomes with limited metabolic capabilities .

  • Ion Homeostasis and Physiological Adaptation:
    The Na+-NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na+ ions from the cytoplasm to the periplasm . This ion translocation is likely critical for maintaining proper intracellular pH, membrane potential, and other physiological parameters that affect virulence.

  • Potential as a Drug Target:
    Na+-NQR is found in many pathogenic bacteria but not in humans, making it a promising target for new antibiotics . The Na+-NQR complex is widespread among pathogens like V. cholerae and multidrug-resistant Pseudomonas and Klebsiella strains . Targeting NqrE specifically might disrupt the function of the entire complex, affecting bacterial viability through:

    • Disruption of energy metabolism

    • Disturbance of ion homeostasis

    • Potential membrane depolarization

  • Inhibition Strategies:
    Potential approaches to target NqrE include:

    • Small molecule inhibitors designed to bind specific catalytic or structural sites

    • Peptide inhibitors targeting protein-protein interactions between NqrE and other subunits

    • Inhibition of NqrE expression through antisense technologies

The unique genomic features of C. caviae, including 68 genes that lack orthologs in other completed chlamydial genomes , suggest adaptations specific to its ecological niche. Understanding how the Na+-NQR complex contributes to these adaptations could provide insights into both the basic biology of this organism and potential therapeutic interventions.

How do post-translational modifications affect the structure and function of NqrE in the Na+-NQR complex?

Post-translational modifications (PTMs) likely play crucial roles in regulating NqrE function within the Na+-NQR complex:

  • Covalent Flavin Attachment:
    While the search results don't specifically mention flavin binding to NqrE, the Na+-NQR complex contains two covalently bound flavin mononucleotides (FMNs) . If NqrE contains one of these covalent flavin sites, this would represent a critical PTM affecting electron transfer capabilities.

  • Phosphorylation:
    Bacterial proteins, including those involved in energy metabolism, can be regulated by phosphorylation. Potential effects include:

    • Altered subunit interactions within the complex

    • Modified ion binding or translocation rates

    • Regulation of enzyme activity in response to metabolic conditions

  • Redox Modifications:
    The Na+-NQR complex participates in electron transfer reactions, and redox-sensitive amino acids in NqrE might undergo reversible modifications:

    • Cysteine oxidation (disulfide formation, glutathionylation)

    • Methionine oxidation

    • These modifications could serve as regulatory switches or affect protein stability

  • Experimental Approaches to Study PTMs in NqrE:

PTM TypeDetection MethodFunctional Analysis Approach
Covalent flavin bindingFluorescence spectroscopy, Mass spectrometrySite-directed mutagenesis of attachment sites
PhosphorylationPhosphoproteomic analysis, Pro-Q Diamond stainingPhosphomimetic mutations (S/T→D/E), Phospho-null mutations (S/T→A)
Redox modificationsRedox proteomics, Differential alkylationMutation of redox-sensitive residues (C→S/A)
Other PTMsMass spectrometrySite-specific mutations, Domain swapping
  • Structure-Function Relationships:
    PTMs might influence the large conformational changes that couple electron transfer to ion translocation in Na+-NQR . Understanding how modifications of NqrE affect these conformational dynamics would provide insight into the molecular mechanism of the complex.

Research on PTMs in bacterial respiratory complexes suggests that these modifications can be dynamically regulated in response to environmental conditions, providing a mechanism for adaptation to changing metabolic demands or stress conditions. Characterizing the PTMs of NqrE would therefore contribute to understanding how C. caviae adjusts its energy metabolism during different stages of its life cycle or under various environmental stresses.

What are the critical considerations when designing site-directed mutagenesis experiments to study the functional domains of NqrE?

When designing site-directed mutagenesis experiments to study the functional domains of NqrE, researchers should consider:

  • Selection of Target Residues:

    • Conserved residues identified through multiple sequence alignments

    • Charged residues in predicted transmembrane regions (potential ion pathway)

    • Residues predicted to interact with cofactors or other subunits

    • Residues in regions showing conformational changes based on structural studies

  • Types of Mutations:

Mutation TypePurposeExample
ConservativeTest importance of side chain properties while minimizing structural disruptionD→E, K→R, V→I
Non-conservativeTest requirement for specific chemical propertiesD→A, K→A, Y→F
Charge reversalTest electrostatic interactionsD→K, K→E
Cysteine scanningMap accessible surfaces, potential for subsequent chemical modificationX→C
Incorporation of unnatural amino acidsProbe specific chemical interactions, introduce crosslinking sitesIncorporation of photo-crosslinkable amino acids
  • Experimental Controls:

    • Include mutations known to affect function in related proteins

    • Create control mutations in non-conserved, surface-exposed residues

    • Prepare wildtype protein in parallel under identical conditions

  • Readout Systems:

    • Enzymatic activity assays (NADH oxidation, quinone reduction)

    • Ion translocation measurements

    • Assembly assays to confirm proper complex formation

    • Thermal stability measurements to assess structural integrity

  • Structure-Based Design:
    While specific structural information for C. caviae NqrE isn't provided in the search results, researchers could use related structures, such as those from V. cholerae Na+-NQR , to guide mutagenesis. The V. cholerae Na+-NQR shows that subunit movements act as an electron transfer switch that controls the release of Na+ from a binding site localized in subunit NqrB . Similar mechanisms might exist in C. caviae, and mutagenesis could target residues potentially involved in these conformational changes.

Properly designed mutagenesis experiments should aim to distinguish between residues involved in catalysis, ion binding, subunit interactions, and structural stability, providing a comprehensive understanding of NqrE function within the complex.

How can researchers effectively use cryo-EM and X-ray crystallography to elucidate the structure of the Na+-NQR complex containing NqrE?

Researchers can effectively use cryo-EM and X-ray crystallography to elucidate the structure of the Na+-NQR complex containing NqrE by following these methodological approaches:

  • Sample Preparation Optimization:

    For Cryo-EM:

    • Purify homogeneous Na+-NQR complex in detergent micelles or nanodiscs

    • Screen multiple detergents or nanodisc compositions

    • Optimize protein concentration (typically 0.5-5 mg/ml)

    • Test various grid types and freezing conditions

    For X-ray Crystallography:

    • Screen numerous crystallization conditions (commercial sparse matrix screens)

    • Test different detergents, LCP (Lipidic Cubic Phase), or crystallization in bicelles

    • Incorporate antibody fragments or designed ankyrin repeat proteins (DARPins) to increase polar contacts

    • Try co-crystallization with inhibitors or substrates to stabilize specific conformations

  • Data Collection Strategies:

    For Cryo-EM:

    • Collect data in different redox states to capture conformational changes

    • Use energy filters to improve signal-to-noise ratio

    • Implement beam-induced motion correction

    • Consider collecting tilt series for challenging orientations

    For X-ray Crystallography:

    • Optimize cryo-protection protocols

    • Use microfocus beamlines for small crystals

    • Implement helical data collection for needle-shaped crystals

    • Consider serial crystallography at XFELs for microcrystals

  • Structure Determination Workflow:

    Based on the V. cholerae Na+-NQR study, both techniques can be complementary:

    • Cryo-EM was used to determine structures representing different states in the catalytic cycle

    • X-ray crystallography provided additional structural insights

    This combined approach can be particularly powerful for membrane protein complexes like Na+-NQR.

  • Validation Methods:

    • Cross-validate structures from both methods

    • Perform mutagenesis of key residues identified in the structures

    • Use molecular dynamics simulations to test stability of the model

    • Verify cofactor positions with spectroscopic techniques

  • Functional Interpretation:

    • Map the electron transfer pathway through the complex

    • Identify the Na+ binding site(s) and translocation pathway

    • Characterize conformational changes between different states

    • Compare with structures from other species to identify conserved mechanisms

The structure of Na+-NQR from V. cholerae revealed that ion pumping is driven by large conformational changes coupling electron transfer to ion translocation . A similar approach for C. caviae Na+-NQR would help determine whether the same mechanism applies across different bacterial species and provide insights into any species-specific adaptations.

What are the most appropriate heterologous expression systems for functional studies of complete Na+-NQR complexes containing recombinant NqrE?

Selecting the appropriate heterologous expression system for functional studies of complete Na+-NQR complexes containing recombinant NqrE requires careful consideration of multiple factors:

  • Comparison of Expression Systems:

Expression SystemAdvantagesDisadvantagesSuitability for Na+-NQR
E. coliWell-established protocols, fast growth, inexpensive, genetic tools availableMay lack appropriate chaperones, limited PTMs, improper membrane insertion possibleGood for initial screening and mutagenesis studies
Yeast (S. cerevisiae, P. pastoris)Eukaryotic folding machinery, higher protein yields, scalableGlycosylation patterns differ from bacteria, potential codon biasModerate; good for expression of individual subunits
Insect cells (Sf9, Hi5)Advanced folding machinery, suitable for complex proteinsExpensive, time-consuming, complex media requirementsGood for expression of full complexes requiring careful assembly
Cell-free systemsRapid, direct access to reaction conditions, toxic protein compatibleLimited post-translational modifications, expensive for scale-upUseful for mechanistic studies and incorporation of unnatural amino acids
Native host (Chlamydia)Natural environment, all required factors presentDifficult to manipulate genetically, biosafety concernsChallenging but most authentic context
  • Optimizing Multi-Subunit Expression:

    • Polycistronic constructs ensuring proper stoichiometry

    • Sequential induction systems for ordered assembly

    • Co-expression of chaperones specific to membrane protein folding

    • Inclusion of biosynthetic enzymes for cofactor incorporation

  • Membrane Environment Considerations:

    • Supplement growth media with membrane components similar to native environment

    • Consider using E. coli strains with modified membrane compositions

    • For functional studies, reconstitution into liposomes with defined lipid composition

  • Cofactor Incorporation:
    The Na+-NQR complex contains multiple cofactors including FAD, FMNs, riboflavin, and iron-sulfur centers . Ensuring proper incorporation requires:

    • Supplementation of growth media with cofactor precursors

    • Optimization of growth conditions to promote cofactor biosynthesis

    • Possible co-expression of cofactor assembly proteins

  • Functional Validation Methods:

    • Spectroscopic characterization of incorporated cofactors

    • NADH oxidation and quinone reduction assays

    • Na+ transport measurements in reconstituted systems

    • Thermal stability assays to verify proper complex assembly

Based on the complexity of the Na+-NQR complex and its multiple cofactors , a strategic approach might involve initial expression and characterization of individual subunits in E. coli, followed by progressive assembly of subcomplexes, and finally expression of the complete complex in a more sophisticated system like insect cells if needed for detailed mechanistic studies.

How can structural and functional information about C. caviae NqrE contribute to the development of new antimicrobial strategies?

Structural and functional information about C. caviae NqrE can significantly contribute to antimicrobial development through several research avenues:

  • Target Validation and Druggability Assessment:

    • Na+-NQR is widespread among pathogens but absent in humans, making it a promising antibiotic target

    • Determine whether NqrE contains unique structural features that could be selectively targeted

    • Assess the essentiality of NqrE for C. caviae viability under different conditions

  • Structure-Based Drug Design Strategies:

    • Identify binding pockets specific to NqrE that could accommodate small molecule inhibitors

    • Design peptides that disrupt critical interactions between NqrE and other subunits

    • Develop agents that interfere with cofactor binding or electron transfer

  • Potential Druggable Sites in NqrE:

Site TypeRationalePotential Approach
Interfacial regionsDisrupt complex assemblyPeptide mimetics of interaction interfaces
Cofactor binding sitesPrevent electron transferCompetitive inhibitors resembling cofactors
Ion translocation pathwayBlock Na+ transportChannel blockers designed from structural data
Conformational change sitesPrevent conformational switchingAllosteric inhibitors that lock conformation
  • Broad-Spectrum vs. Species-Specific Strategies:

    • Compare NqrE structures across bacterial species to identify conserved druggable sites for broad-spectrum activity

    • Target unique features of C. caviae NqrE for species-specific inhibitors

    • Design combination approaches targeting multiple subunits of the Na+-NQR complex

  • Alternative Therapeutic Approaches:

    • Develop vaccines based on exposed epitopes of NqrE

    • Design CRISPR-based antimicrobials targeting nqrE gene

    • Explore phage therapy approaches that could deliver inhibitors specifically to Chlamydia

The Na+-NQR complex from V. cholerae has been identified as a promising target for new antibiotics, particularly for multidrug-resistant pathogens like Pseudomonas and Klebsiella strains . Similar potential exists for targeting the C. caviae Na+-NQR complex, which could lead to new treatments for chlamydial infections that are increasingly resistant to current antibiotics.

What insights can comparative genomics provide about the evolution and adaptation of the Na+-NQR complex in Chlamydophila species?

Comparative genomics offers valuable insights into the evolution and adaptation of the Na+-NQR complex in Chlamydophila species:

  • Evolutionary History and Conservation:
    The C. caviae genome contains 1,009 annotated genes, of which 798 are conserved across all other completed Chlamydiaceae genomes . Analysis of Na+-NQR genes within this context could reveal:

    • Whether the Na+-NQR complex is part of the core Chlamydiaceae genome

    • If gene order and operon structure are conserved across species

    • Patterns of selective pressure on different subunits

  • Horizontal Gene Transfer Events:
    The C. caviae genome contains evidence of horizontal gene transfer, particularly in the replication termination region (RTR), which includes gene clusters more similar to C. muridarum than to the phylogenetically closest species C. pneumoniae . This suggests:

    • Possible acquisition of metabolic capabilities through horizontal transfer

    • Potential adaptation of energy generation systems for specific hosts

    • Evolution of specialized Na+-NQR variants for different ecological niches

  • Niche-Specific Adaptations:
    C. caviae contains 68 genes that lack orthologs in any other completed chlamydial genomes, indicating niche-specific functions . Assessment of Na+-NQR in this context could reveal:

    • Modifications to the complex related to the guinea pig conjunctival epithelium (natural host)

    • Adaptations that differentiate it from human-associated Chlamydia species

    • Functional innovations that contribute to host specificity

  • Computational Analysis of Selective Pressure:

Analysis TypeApplication to Na+-NQRExpected Insights
dN/dS ratio analysisCompare substitution rates across Chlamydia speciesIdentify subunits under positive selection
Ancestral sequence reconstructionInfer evolutionary changes in NqrETrace the acquisition of novel functions
Protein structural modelingCompare predicted structures across speciesIdentify structural adaptations to different hosts
Coevolution analysisDetect correlated mutations across subunitsMap functional interactions between subunits
  • Integration with Functional Data:

    • Correlate genomic changes with differences in ion specificity or catalytic efficiency

    • Identify residues that might contribute to adaptation to different host environments

    • Guide experimental studies on species-specific features

The genomic analysis of C. caviae has already revealed that it provides a good model for the Chlamydiaceae family and a point of comparison against the human atherosclerosis-associated C. pneumoniae . Further comparative analysis focused specifically on the Na+-NQR complex would enhance our understanding of how energy generation systems have evolved in these obligate intracellular pathogens.

What are the most promising directions for applying systems biology approaches to understand the role of Na+-NQR in C. caviae metabolism and pathogenesis?

Systems biology approaches offer powerful frameworks for understanding the role of Na+-NQR in C. caviae metabolism and pathogenesis:

Modeling ApproachApplication to Na+-NQRExpected Insights
Constraint-based modeling (FBA)Integrate Na+-NQR into genome-scale metabolic modelsPredict system-wide effects of Na+-NQR inhibition
Kinetic modelingDevelop detailed models of electron transfer and ion translocationUnderstand rate-limiting steps and regulatory points
Agent-based modelingSimulate Na+-NQR role during host-pathogen interactionsPredict infection dynamics under different conditions
Multi-scale modelingLink molecular events to cellular and host-level phenomenaConnect Na+-NQR function to pathogenesis
  • Integration with Host-Pathogen Interaction Data:

    • Analyze Na+-NQR activity during different stages of the chlamydial developmental cycle

    • Determine how host cell metabolism affects Na+-NQR function and vice versa

    • Identify host factors that influence Na+-NQR activity

  • Experimental Validation Approaches:

    • CRISPR interference to modulate Na+-NQR expression

    • Chemical genetic screens to identify synthetic lethal interactions

    • Metabolic flux analysis using stable isotope labeling

    • Time-resolved studies correlating Na+-NQR activity with developmental transitions

C. caviae provides a good model for the Chlamydiaceae family , and systems biology approaches would help place the Na+-NQR complex within the broader context of chlamydial metabolism and host interaction. Given that the C. caviae genome contains unique genes not found in other chlamydial species , systems-level analysis would be particularly valuable for understanding how Na+-NQR contributes to the specific adaptations of this organism to its ecological niche.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.