Recombinant Chlamydophila caviae Probable disulfide formation protein (CCA_00587)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Chlamydophila caviae Probable Disulfide Formation Protein (CCA_00587) is a 136-amino-acid protein (UniProt ID: Q822U2) expressed in Escherichia coli for research applications. Its sequence includes conserved cysteine residues critical for disulfide bond formation, with the following key features :

PropertyDetails
SpeciesChlamydophila caviae (strain GPIC)
Expression SystemE. coli
TagDetermined during production (commonly His-tag)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
Purity>90% (SDS-PAGE verified)
SequenceMIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYREDNLVKIYALPLSITGMVIAVYQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALAFCAISCLLILSGSKKK

The protein functions as a thiol-disulfide oxidoreductase, facilitating disulfide bond formation in periplasmic or membrane-associated proteins critical for bacterial pathogenicity .

Functional Role in Chlamydophila caviae

CCA_00587 is a homolog of Chlamydia trachomatis CT_176, which interacts with DsbB to regulate disulfide bond formation during the chlamydial developmental cycle . Key findings include:

  • Developmental Cycle Regulation: Disulfide bond formation is essential for the structural integrity of the chlamydial outer membrane complex (COMC), particularly during the transition from replicative reticulate bodies (RBs) to infectious elementary bodies (EBs) .

  • Oxidative Folding: CCA_00587 likely stabilizes secreted virulence factors by catalyzing the oxidation of cysteine residues, similar to DsbA in E. coli .

Comparative Analysis with Homologs

CCA_00587 shares structural and functional similarities with disulfide-forming proteins across Chlamydiaceae:

ProteinSpeciesUniProt IDKey Features
CCA_00587C. caviaeQ822U2136 aa, periplasmic cysteines (C404, C425)
CT_176C. trachomatisO84179135 aa, interacts with DsbB for COMC oxidation
Cpn0585C. pneumoniaeQ9Z7G1Inclusion membrane protein with early expression kinetics

Unlike CT_176, CCA_00587 is not directly linked to inclusion membrane dynamics but shares redox-active cysteines (C404 and C425) essential for structural stability .

Pathogenicity Link

  • Host Interaction: While not directly an inclusion membrane protein (unlike Cpn0585 ), CCA_00587 supports virulence by ensuring proper folding of outer membrane proteins (e.g., MOMP) .

  • Immune Evasion: Homologs like CT_176 modulate host membrane trafficking to suppress interferon responses , suggesting analogous roles for CCA_00587.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Synonyms
CCA_00587; Probable disulfide formation protein; Disulfide oxidoreductase; Thiol-disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Chlamydophila caviae (strain GPIC)
Target Names
CCA_00587
Target Protein Sequence
MIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYRE DNLVKIYALPLSITGMVIAVYQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALA FCAISCLLILSGSKKK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlamydophila caviae and why is CCA_00587 significant for research?

Chlamydophila caviae is a species of pathogenic bacteria belonging to the Chlamydiaceae family. These bacteria are obligate intracellular parasites that cause infections in various hosts. C. caviae specifically serves as an excellent model for naturally occurring Chlamydia trachomatis infections in humans, despite being phylogenetically distant. The similarities extend to transmission mechanisms (e.g., sexual), chronic immune-mediated disease progression, and pathologic endpoints .

CCA_00587, identified as a probable disulfide formation protein in C. caviae, is significant because proteins involved in disulfide bond formation play crucial roles in bacterial protein folding and virulence. Understanding this protein contributes to our knowledge of C. caviae pathogenesis and potentially provides insights into similar proteins across the Chlamydiaceae family.

How does CCA_00587 compare to other disulfide formation proteins in the Chlamydiaceae family?

The disulfide formation proteins across Chlamydiaceae species share functional similarities but exhibit specific variations that reflect their adaptation to different hosts and niches. Comparative genomic analysis of Chlamydiaceae has revealed both conserved and unique genes across species . While specific comparative data for CCA_00587 is limited, the general pattern in Chlamydiaceae suggests that:

  • Core functional domains remain conserved across species

  • Sequence variations exist that may relate to host-specific adaptations

  • Gene organization in the chlamydial genomes shows both conserved synteny and rearrangements

Researchers should approach the comparative analysis of CCA_00587 by performing detailed sequence alignment with homologs from C. trachomatis, C. pneumoniae, and C. muridarum to identify conserved functional domains and species-specific variations.

What is the predicted structure and function of CCA_00587 based on bioinformatic analysis?

As a probable disulfide formation protein, CCA_00587 likely functions similarly to other disulfide bond-forming proteins, such as Protein Disulfide Isomerase (PDI). These proteins typically:

  • Catalyze the formation of disulfide bonds in nascent proteins

  • Assist in protein folding by facilitating the correct pairing of cysteine residues

  • May serve as placeholders that allow substrates to guide the pairing of cysteines into native disulfide bonds

The predicted structure likely includes thioredoxin-like domains containing the characteristic CXXC active site motif, which is essential for the thiol-disulfide exchange reactions. Based on PDI studies, the protein may alternate between oxidized and reduced states to facilitate disulfide bond formation in substrate proteins .

What are the optimal expression systems for producing recombinant CCA_00587?

Based on established protocols for similar bacterial proteins, the following expression systems can be considered for CCA_00587:

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coliHigh yield, cost-effective, rapid growthPotential incorrect folding, lack of post-translational modificationsBL21(DE3) strain, 16-20°C induction temperature, 0.1-0.5 mM IPTG
YeastBetter folding than E. coli, some post-translational modificationsLower yield than E. coli, longer growth timePichia pastoris, methanol induction, 25-30°C
BaculovirusSuperior folding, post-translational modificationsComplex setup, higher cost, longer expression timeSf9 or Hi5 cells, 27°C, harvest 48-72h post-infection
Mammalian CellNative-like folding and modificationsLowest yield, highest costHEK293 or CHO cells, transient or stable expression

The choice among these systems should be guided by the research requirements, balancing yield against proper folding and functional activity. For initial characterization, E. coli-based expression is often suitable, while more advanced functional studies may benefit from eukaryotic expression systems .

What purification challenges are specific to CCA_00587, and how can they be addressed?

Purification of disulfide formation proteins presents several challenges due to their redox-active nature:

  • Maintaining redox state: During purification, the protein's active CXXC sites may undergo unwanted oxidation or reduction. Solution: Include appropriate redox buffers (e.g., DTT for reduced state or oxidized/reduced glutathione mixtures for native state).

  • Preventing aggregation: Improper disulfide formation during expression can lead to aggregation. Solution: Express at lower temperatures (16-20°C) and include folding enhancers like sorbitol or arginine in lysis buffers.

  • Preserving activity: Harsh purification conditions may affect the catalytic function. Solution: Implement gentle purification strategies using affinity tags (His-tag, GST) followed by size exclusion chromatography.

  • Removing contaminating proteins: Bacterial expression can result in contaminating proteins. Solution: Use multiple orthogonal purification steps and consider on-column refolding for proteins expressed in inclusion bodies.

A typical purification workflow would include IMAC (Immobilized Metal Affinity Chromatography) followed by ion-exchange chromatography and a final polishing step using size exclusion chromatography.

How can researchers verify the correct folding and activity of purified recombinant CCA_00587?

Verification of correct folding and activity should employ multiple complementary approaches:

  • Structural analysis:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to confirm compact folding

  • Functional assays:

    • Insulin reduction assay: Measures the ability to catalyze disulfide bond reduction

    • RNase refolding assay: Evaluates capability to assist in oxidative protein folding

    • Mixed disulfide capture assays: Identifies substrate interactions

  • Redox state analysis:

    • Ellman's reagent (DTNB) to quantify free thiols

    • AMS or PEG-maleimide labeling to assess the oxidation state of cysteine residues

    • Mass spectrometry to precisely map disulfide bond patterns

Researchers should establish a correlation between structural integrity and enzymatic activity to confirm that the recombinant protein is properly folded and functionally active.

What in vitro assays are most informative for studying CCA_00587's disulfide formation activity?

Several complementary in vitro assays can provide comprehensive insights into CCA_00587's disulfide formation activity:

  • Insulin turbidity assay: Measures the rate of insulin precipitation when its disulfide bonds are reduced, indicating the protein's disulfide reductase activity.

  • RNase A refolding assay: Evaluates the ability to catalyze the oxidative folding of denatured and reduced RNase A, monitored by recovery of RNase enzymatic activity.

  • Single-molecule force spectroscopy: Uses Atomic Force Microscopy (AFM) to monitor the formation and breaking of disulfide bonds in real-time at the single-molecule level, as demonstrated with PDI .

  • Fluorescence-based redox assays: Employs fluorescent probes sensitive to disulfide formation/reduction to monitor activity kinetics.

  • Substrate trapping assays: Uses mutated versions of CCA_00587 where one cysteine in the active CXXC motif is substituted to stabilize enzyme-substrate mixed disulfides, enabling identification of physiological substrates.

The combination of these assays provides a comprehensive picture of the protein's oxidase, reductase, and isomerase activities under varying redox conditions.

How can researchers identify the substrate proteins of CCA_00587 in Chlamydophila caviae?

Identifying the natural substrates of CCA_00587 requires a multi-faceted approach:

  • Substrate-trapping mutants: Engineer CCA_00587 variants (typically by mutating the C-terminal cysteine in the CXXC motif) that form stable mixed disulfides with substrates, followed by affinity purification and mass spectrometry identification.

  • Proximity-based labeling: Use techniques like BioID or APEX2 fused to CCA_00587 to biotinylate nearby proteins in vivo, followed by streptavidin pulldown and identification.

  • Comparative proteomics: Compare the disulfide proteome of wild-type C. caviae with CCA_00587 knockout or depleted strains using differential alkylation and mass spectrometry.

  • Bioinformatic prediction: Analyze the C. caviae proteome for secreted proteins with multiple cysteines that might require disulfide bonds for proper folding.

  • Co-immunoprecipitation studies: Similar to techniques used for identifying protein interactions with TSHR and CD40 , use antibodies against CCA_00587 to pull down interacting proteins.

These approaches should be used in combination, as each has strengths and limitations in identifying both stable and transient substrate interactions.

How can structural biology approaches enhance our understanding of CCA_00587 function?

Advanced structural biology techniques can provide critical insights into CCA_00587's function:

  • X-ray crystallography: Determining the high-resolution structure would reveal the spatial arrangement of catalytic domains, substrate binding regions, and the precise geometry of the active sites. Co-crystallization with substrate peptides could illuminate the molecular basis of substrate recognition.

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for capturing different conformational states during the catalytic cycle, offering insights into the dynamic aspects of CCA_00587 function.

  • NMR spectroscopy: Provides information on protein dynamics in solution, especially valuable for identifying flexible regions that may be involved in substrate binding or intermolecular interactions.

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): Maps regions of conformational flexibility and protein-protein interaction surfaces under physiologically relevant conditions.

  • Molecular dynamics simulations: Based on experimental structures, can predict conformational changes during catalytic cycles and identify potential allosteric regulation sites.

These approaches, when combined with functional studies, can lead to a mechanistic understanding of how CCA_00587 recognizes and modifies its substrates, potentially revealing unique features compared to other disulfide formation proteins.

What are the challenges and solutions for studying CCA_00587 in the context of live C. caviae infections?

Studying CCA_00587 in live infection contexts presents several challenges:

ChallengeSolutionMethodological Considerations
Obligate intracellular lifestyle of C. caviaeDevelop cell culture infection modelsUse appropriate host cells (e.g., guinea pig epithelial cells); monitor infection by immunofluorescence
Limited genetic manipulation toolsImplement conditional expression systemsConsider CRISPRi for knockdown; use inducible promoters for complementation
Difficulty tracking protein in situEmploy specific antibodies or tagged versionsValidate that tags don't disrupt function; use super-resolution microscopy
Complex host-pathogen interactionsDevelop ex vivo tissue modelsOrganoids or tissue explants can better recapitulate in vivo conditions
Redox environment changes during infectionUse redox-sensitive probesMonitor compartmental redox changes during infection cycle

C. caviae provides a valuable model for human chlamydial infections, with mechanisms of transmission and disease progression similar to C. trachomatis infections in humans . This makes it particularly valuable for studying pathogenesis despite the technical challenges.

How does CCA_00587 compare to disulfide formation proteins in other bacterial pathogens, and what evolutionary insights can be gained?

Comparative analysis of CCA_00587 with disulfide formation proteins in other bacterial pathogens reveals evolutionary adaptations to different ecological niches:

  • Evolutionary conservation: Core catalytic domains and CXXC motifs are typically highly conserved across bacterial species, reflecting the fundamental nature of disulfide chemistry in protein folding.

  • Domain architecture variations: Variations in auxiliary domains, substrate binding regions, and regulatory elements reflect adaptations to specific bacterial lifestyles and substrate repertoires.

  • Genomic context: The location of disulfide formation protein genes in the genome can provide insights into co-evolution with their substrates. In C. caviae, genome sequencing has revealed that the replication termination region (RTR) is a hotspot for genome variation .

  • Horizontal gene transfer: Some gene clusters in C. caviae are more similar to those in C. muridarum than to C. pneumoniae, suggesting possible horizontal transfer between rodent-associated Chlamydiae . This could impact the evolution of protein folding machinery.

Researchers should apply phylogenetic analysis to disulfide formation proteins across bacterial species, correlating sequence divergence with bacterial lifestyle (intracellular vs. extracellular, obligate vs. facultative parasites) to understand how these critical enzymes have evolved.

What are the optimal conditions for storing and handling recombinant CCA_00587 to maintain its activity?

Proper storage and handling are critical for maintaining the activity of redox-sensitive proteins like CCA_00587:

Storage ConditionRecommended ProtocolActivity Retention
Short-term (1-2 weeks)4°C in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 1 mM DTT>90%
Medium-term (1-3 months)-20°C in buffer with 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 50% glycerol, 1 mM DTT70-90%
Long-term (>3 months)-80°C in small aliquots, buffer with 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 1 mM DTT>80% if properly aliquoted
Working conditionsMaintain on ice, use within 8 hours, avoid repeated freeze-thaw cyclesVaries by specific handling

Additional considerations:

  • Maintain reducing conditions (typically 1-5 mM DTT) to prevent unwanted oxidation of catalytic cysteines

  • Consider protein concentration (0.5-5 mg/mL is typically optimal)

  • Avoid exposure to heavy metals which can interfere with thiol groups

  • Validate activity after storage using standard assays (e.g., insulin turbidity assay)

What are the best approaches for developing inhibitors or modulators of CCA_00587 activity for research purposes?

Developing specific modulators of CCA_00587 activity requires a systematic approach:

  • Structure-based design: If crystal structures are available, use computational docking to identify small molecules that bind to active sites or allosteric regions.

  • Fragment-based screening: Identify small chemical fragments that bind to the protein, then gradually expand these into larger, more potent compounds.

  • High-throughput screening: Develop a robust activity assay amenable to screening compound libraries, focusing on:

    • Natural product libraries (particularly from sources rich in disulfide-containing compounds)

    • Redox-active compound collections

    • Peptide libraries mimicking substrate binding regions

  • Rational design based on mechanism: Design compounds that specifically target the CXXC active site, potentially including:

    • Irreversible inhibitors that form covalent bonds with active site cysteines

    • Competitive inhibitors that mimic natural substrates

    • Allosteric modulators that alter the redox potential of the active site

  • Validation methods:

    • Enzyme kinetics to determine inhibition mechanisms

    • Thermal shift assays to confirm binding

    • Cellular assays to verify activity in more complex environments

    • Selectivity profiling against related disulfide formation proteins

These approaches should be complemented with careful consideration of compound specificity to ensure that effects observed are due to specific CCA_00587 inhibition rather than general redox effects.

How can researchers effectively use recombinant CCA_00587 as a tool to study protein folding mechanisms?

Recombinant CCA_00587 can serve as a valuable tool for investigating fundamental protein folding mechanisms:

  • In vitro folding studies: Use purified CCA_00587 to assist the folding of model proteins, comparing folding kinetics and yields in the presence and absence of the enzyme. This can reveal how disulfide formation affects folding pathways.

  • Single-molecule approaches: Apply techniques like atomic force microscopy (AFM) to monitor the effect of CCA_00587 on substrate proteins at the single-molecule level, as demonstrated with PDI . This allows direct observation of enzyme-substrate interactions during folding.

  • Mixed disulfide analysis: Capture and characterize enzyme-substrate intermediates to determine how CCA_00587 influences the folding trajectory of substrate proteins.

  • Comparative folding studies: Compare how CCA_00587 and other disulfide formation proteins from different organisms affect the folding of the same substrate proteins to identify organism-specific adaptations.

  • Co-translational folding models: Develop experimental systems that mimic co-translational folding, potentially using ribosome display or similar techniques, to study how CCA_00587 interacts with nascent polypeptides.

These approaches can shed light on how disulfide formation proteins act as placeholders that allow substrates to guide the pairing of cysteines into native disulfide bonds, a mechanism proposed for PDI that may apply to bacterial disulfide formation proteins as well .

How might CCA_00587 be leveraged in the development of new anti-chlamydial strategies?

Targeting CCA_00587 for anti-chlamydial strategies presents several promising avenues:

  • Inhibitor development: Specific inhibitors of CCA_00587 could prevent proper folding of essential virulence factors and surface proteins, potentially attenuating bacterial infectivity and survival.

  • Attenuated vaccine development: Strains with modified CCA_00587 activity could serve as attenuated live vaccine candidates, maintaining immunogenicity while reducing pathogenicity.

  • Diagnostic applications: Antibodies against CCA_00587 or detection of the protein itself could be developed into diagnostic tools for C. caviae infection.

  • Combination therapies: Inhibitors of disulfide formation could sensitize Chlamydia to existing antibiotics by compromising bacterial stress responses.

  • Broad-spectrum applications: Insights from CCA_00587 could inform the development of broader strategies targeting disulfide formation across multiple chlamydial species, potentially addressing human pathogens like C. trachomatis.

The obligate intracellular lifestyle of Chlamydia makes traditional antibiotic development challenging, making these alternative approaches particularly valuable for future therapeutic development.

What novel techniques are emerging for studying disulfide formation proteins that could be applied to CCA_00587?

Several cutting-edge techniques show promise for advancing our understanding of CCA_00587:

  • Redox proteomics with quantitative mass spectrometry: Allows global profiling of disulfide bond formation in the presence and absence of CCA_00587, revealing its substrate specificity and impact on the cellular redox network.

  • Cryo-electron tomography: Enables visualization of CCA_00587 in its native cellular context, potentially revealing its localization and interactions within the bacterial cell.

  • Time-resolved structural methods: X-ray free-electron lasers (XFELs) and time-resolved crystallography can capture short-lived conformational states during the catalytic cycle.

  • Deep mutational scanning: Systematic analysis of thousands of CCA_00587 variants can identify residues critical for different aspects of its function and provide insights into its evolutionary constraints.

  • Microfluidic approaches: Allow real-time monitoring of enzyme kinetics under precisely controlled redox conditions, potentially revealing how CCA_00587 activity is modulated by environmental factors.

  • AlphaFold2 and other AI-based structural prediction: These tools can predict protein structures with unprecedented accuracy, potentially revealing structural features of CCA_00587 and its interactions with substrates even in the absence of experimental structures .

These emerging techniques, when applied to CCA_00587, could revolutionize our understanding of disulfide formation in bacterial systems and open new avenues for therapeutic intervention.

How does the function of CCA_00587 integrate with other protein quality control systems in C. caviae?

Understanding how CCA_00587 integrates with other protein quality control systems provides a holistic view of protein homeostasis in C. caviae:

  • Coordination with chaperone systems: Disulfide formation proteins often work in concert with molecular chaperones like DnaK/DnaJ and GroEL/GroES. Research should investigate whether CCA_00587 physically or functionally interacts with these systems.

  • Integration with proteolytic systems: When protein folding fails, proteolytic degradation ensues. The relationship between CCA_00587 activity and proteases like Lon, ClpP, and HtrA in C. caviae merits investigation.

  • Redox homeostasis networks: CCA_00587 likely functions within a broader network of redox-regulating proteins. Mapping these interactions could reveal regulatory mechanisms controlling disulfide formation.

  • Stress response coordination: During infection, bacteria encounter various stresses. Research should examine how CCA_00587 activity is modulated during stress responses and how this affects global protein folding.

  • Temporal regulation during the developmental cycle: Chlamydial species undergo a unique developmental cycle alternating between infectious elementary bodies (EBs) and replicative reticulate bodies (RBs). The role of CCA_00587 may vary between these stages, particularly given the importance of disulfide bonds in EB outer membrane proteins.

A systems biology approach integrating transcriptomics, proteomics, and functional studies across the developmental cycle would provide valuable insights into how CCA_00587 functions within the broader context of cellular protein homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.