Recombinant Chlamydophila felis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biological Role in C. felis

  • Function: Cleaves signal peptides from prolipoproteins, a critical step in lipoprotein maturation. Lipoproteins anchor to bacterial membranes and mediate host-cell interactions .

  • Genomic Context: The lspA gene (CF0797) is part of the C. felis core genome, conserved across Chlamydiaceae species, indicating evolutionary importance .

  • Structural Insights: The absence of peptidoglycan in C. felis cell walls elevates the role of lipoproteins in maintaining membrane rigidity and pathogen survival .

Diagnostic Development

Recombinant lspA is utilized in ELISA kits to detect C. felis-specific antibodies in feline serum, aiding in diagnosing conjunctivitis and respiratory infections . Its high specificity reduces cross-reactivity with other Chlamydia species (e.g., C. psittaci or C. pneumoniae) .

Mechanistic Studies

Studies leverage recombinant lspA to:

  • Investigate lipoprotein processing in C. felis’s biphasic life cycle (elementary vs. reticulate bodies) .

  • Screen inhibitors targeting signal peptidase activity, a potential therapeutic avenue .

Comparative Analysis with Other Chlamydia Enzymes

FeatureC. felis lspAHomologs in Other Chlamydia Species
Substrate SpecificityPrefers lipoproteins with Ala-rich signal peptidesBroader specificity in C. trachomatis
Gene Conservation98% sequence similarity to C. psittaci lspADivergent in C. pneumoniae (85% similarity)
Role in PathogenicityEssential for membrane biogenesisLinked to immune evasion in C. abortus

Phylogenetic analyses suggest lspA’s structure-function relationship is optimized for C. felis’s niche in feline ocular and respiratory epithelia .

Technical Considerations for Use

  • Purity: >90% by SDS-PAGE, confirmed via Coomassie staining .

  • Activity Assays: Requires detergents (e.g., Triton X-100) to solubilize lipoprotein substrates in vitro .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquot storage is recommended .

Research Gaps and Future Directions

  • Structural Data: No crystallography or cryo-EM structures exist for C. felis lspA, limiting mechanistic insights.

  • In Vivo Role: Knockout studies are needed to confirm lspA’s necessity for C. felis infectivity.

  • Zoonotic Potential: Cross-reactivity with human lipoproteins remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format we have in stock, we understand you may have specific requirements. Please indicate your preferred format during order placement and we will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its inclusion whenever possible.
Synonyms
lspA; CF0797; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Chlamydia felis (strain Fe/C-56) (Chlamydophila felis)
Target Names
lspA
Target Protein Sequence
MSNRSRSTLLTISFFVLIDWVTKLAVLLYRGNLPNANPILYQYSWGKLFFCICPTFNEGA AFGLFSKYKYFLLLIRIVIILGILAFLFLRKKKTSATTRFSLILLCSGAIGNVGDIFFYN HVIDFISIGYNRWSFPTFNFADIFISLGTLIFVYKLYFPTKQKIK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: cfe:CF0797

STRING: 264202.CF0797

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of lipoprotein signal peptidase (lspA) in Chlamydia felis?

Lipoprotein signal peptidase (lspA) in C. felis functions as a type II signal peptidase (SPase II), responsible for cleaving signal peptides from prolipoproteins after they've been modified by prolipoprotein diacylglyceryl transferase (encoded by lgt). This processing is essential for proper localization and function of lipoproteins in the bacterial membrane. As an obligate intracellular parasite, C. felis depends on efficient protein processing for its survival and virulence . By analogy with other bacterial pathogens, lipoprotein processing by SPase II is likely critical for intracellular growth and pathogenicity in C. felis .

Methodological approach to study this role:

  • Generate recombinant C. felis lspA and assess its ability to complement temperature-sensitive E. coli lspA mutants

  • Measure globomycin resistance (a specific SPase II inhibitor) as a functional readout

  • Perform comparative analysis with lspA from other intracellular pathogens like Rickettsia typhi

How does C. felis lspA expression change during infection?

Based on data from studies of other intracellular bacteria like Rickettsia typhi, C. felis lspA likely shows a differential expression pattern during various stages of infection. In R. typhi, higher transcriptional levels of lspA, lgt, and lepB were observed at preinfection, followed by a decrease until 8 hours post-infection, then increasing with peaks at 48 hours, and decreasing again at 120 hours when host cells begin to lyse .

For C. felis, which causes primarily conjunctivitis in cats, the expression pattern may correlate with its developmental cycle transitioning between elementary bodies (EBs) and metabolically active reticulate bodies (RBs). The expression is likely highest when the bacterium is actively replicating and processing new lipoproteins.

Infection StageExpected lspA ExpressionPhysiological Significance
Initial attachmentModeratePreparation for cell entry
Early intracellular (0-8h)DecreasingTransition to RB forms
Replicative phase (8-48h)HighActive membrane synthesis
Late stage/exit (>48h)DecreasingPreparation for new infection

What conserved domains characterize functional C. felis lspA?

The C. felis lspA protein, like other bacterial SPase II enzymes, likely contains several highly conserved domains essential for its enzymatic activity. Based on comparative genomics with characterized SPase II enzymes, the critical features would include:

  • Multiple transmembrane domains anchoring the protein in the bacterial membrane

  • A catalytic dyad, typically consisting of conserved aspartic acid and asparagine residues

  • Specific binding regions that recognize the lipobox motif in substrate prolipoproteins

  • Membrane-embedded active site positioned to access the lipid-modified cysteine

To experimentally confirm these domains, site-directed mutagenesis of conserved residues followed by functional complementation assays would be required .

What expression systems are optimal for producing recombinant C. felis lspA?

As a membrane-bound protein from an obligate intracellular pathogen, recombinant expression of C. felis lspA presents significant challenges. Based on successful expression of R. typhi lspA in E. coli, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) with pET vector systems, encoding an N-terminal His-tag for purification

  • Controlled expression using IPTG at low concentrations (0.1-0.5 mM)

  • Growth at reduced temperatures (16-20°C) post-induction to minimize inclusion body formation

Critical Parameters for Optimization:

  • Induction timing (mid-log phase)

  • Expression duration (typically 4-6 hours for membrane proteins)

  • Cell lysis conditions (gentle detergent solubilization)

The functionality of expressed lspA can be verified through complementation of temperature-sensitive E. coli lspA mutants (e.g., strain Y815) and measuring increased resistance to globomycin, as demonstrated with R. typhi lspA .

How can C. felis lspA be targeted for antimicrobial development?

LspA represents an attractive antimicrobial target because:

  • It's essential for bacterial viability in gram-negative bacteria

  • It has no human homolog, reducing toxicity concerns

  • It's accessible in the bacterial membrane

  • It's highly conserved across bacterial species

Strategic Approaches for Inhibitor Development:

  • Structural biology to identify unique features of the active site

  • High-throughput screening against purified recombinant C. felis lspA

  • Rational design based on known inhibitors like globomycin

  • Fragment-based drug discovery focusing on the catalytic site

Validation Methods:

  • In vitro enzyme inhibition assays

  • Cell-based infection models using feline cell lines

  • Measurement of lipoprotein processing in the presence of inhibitors

  • Assessment of effects on C. felis development cycle

The membrane-bound nature of LspA makes it accessible to small molecule inhibitors without requiring intracellular penetration, potentially offering advantages for drug delivery .

What experimental approaches can determine the in vivo function of lspA during C. felis infection?

Genetic Manipulation Strategies:

  • RNA interference to knockdown lspA expression

  • Inducible expression systems to control lspA levels during infection

  • Site-directed mutagenesis of key catalytic residues

Infection Models:

  • Feline epithelial cell cultures (mimicking natural host cells)

  • Ex vivo feline conjunctival tissue

  • Experimental infection of cats via ocular route as previously described

Functional Assessment Methods:

  • Quantitative PCR to measure bacterial replication with modified lspA expression

  • Microscopy to track infection progression

  • Profiling of lipoprotein content in wild-type versus lspA-inhibited bacteria

  • Assessment of bacterial dissemination (C. felis has been shown to spread systemically from the eye to organs including lung, liver, spleen, kidney via bacteremia)

Expected Phenotypes:

  • Defects in bacterial attachment to host cells

  • Impaired intracellular replication

  • Attenuated virulence

  • Altered inflammatory response

How does the transcriptional profile of lspA correlate with other lipoprotein processing genes?

Understanding the coordinated expression of lipoprotein processing pathway components provides insights into C. felis adaptation during infection. Based on studies in R. typhi, the transcription of lspA typically correlates with lgt (encoding prolipoprotein transferase), while lepB (encoding type I signal peptidase) often shows higher expression levels .

Recommended Experimental Approach:

  • Real-time quantitative RT-PCR analysis of C. felis-infected cells at multiple time points

  • Sampling schedule: 0h (pre-infection), 2h, 8h, 24h, 48h, 72h post-infection

  • Target genes: lspA, lgt, lnt (lipoprotein N-acyltransferase), lepB (for comparison)

  • Normalization to stable reference genes

Expected Expression Patterns:

  • lspA and lgt likely show similar expression profiles as they function in the same pathway

  • lepB may show higher expression as it processes a broader range of secretory proteins

  • Expression peaks likely correlate with transitions in the developmental cycle

What is the relationship between lspA function and C. felis pathogenesis in the feline host?

C. felis primarily causes conjunctivitis in cats, with signs including hyperemia of the nictitating membrane, blepharospasm, ocular discharge, and chemosis . The role of lspA in this pathogenesis can be investigated through:

Experimental Design:

  • Compare wild-type C. felis with strains having modified lspA expression

  • Track infection progression in feline cell models

  • Monitor bacterial dissemination patterns (C. felis can spread from conjunctiva to other organs)

Pathogenesis Parameters to Measure:

  • Bacterial attachment efficiency to conjunctival epithelium

  • Intracellular replication rates

  • Host inflammatory response markers

  • Bacterial shedding and transmission potential

Methodological Considerations:

  • Use of the C. felis B166 strain or similar well-characterized isolates

  • Standardized infection protocols via ocular route

  • Quantitative assessment of bacterial loads in various tissues

  • Immunological profiling of host response

Evidence from experimental infections shows that C. felis first infects and replicates in the conjunctiva and nictitating membrane, producing symptoms primarily limited to conjunctivitis, before potentially spreading throughout the body via bacteremia . The role of lipoproteins processed by lspA in this progression would provide valuable insights into pathogenesis mechanisms.

How can recombinant C. felis lspA be utilized to develop rapid diagnostic tools?

The development of rapid diagnostic assays for C. felis is important for veterinary medicine. A recombinase-aided amplification (RAA) assay has already been developed for C. felis detection with high sensitivity (10.6 DNA copies per reaction) and specificity . Building on this, lspA-based diagnostics could offer advantages:

Potential Diagnostic Applications:

  • Generation of anti-lspA antibodies for immunodiagnostic assays

  • Development of lspA-specific nucleic acid amplification tests

  • Creation of biosensors targeting lspA or its products

Methodological Considerations:

  • Selection of lspA-specific regions distinct from other Chlamydia species

  • Optimization of assay conditions for clinical sample types

  • Validation against standard diagnostic methods

  • Field testing in veterinary settings

The rapid nature of RAA (can be performed in a closed tube at 39°C within 30 minutes) makes it particularly suitable for point-of-care testing, which could be adapted for lspA-targeted diagnostics.

What comparative genomic approaches can reveal about lspA evolution across Chlamydia species?

Comparative genomics can provide insights into the evolutionary conservation and specialization of lspA across the Chlamydiaceae family, which includes C. trachomatis, C. pneumoniae, C. psittaci, and other species .

Research Methodology:

  • Phylogenetic analysis of lspA sequences from all available Chlamydia genomes

  • Identification of species-specific variations in catalytic and substrate-binding regions

  • Analysis of selection pressures on different lspA domains

  • Correlation of lspA sequence variations with host range and tissue tropism

Expected Insights:

  • Conservation level of catalytic domains versus peripheral regions

  • Identification of host-specific adaptations

  • Potential correlation between lspA variations and pathogenicity

  • Insights into the evolution of lipoprotein processing within the Chlamydiaceae family

How do post-translational modifications affect C. felis lspA activity?

As a membrane-bound enzyme functioning in a complex intracellular environment, C. felis lspA activity may be regulated by various post-translational modifications.

Potential Modifications to Investigate:

  • Phosphorylation of serine/threonine/tyrosine residues

  • Lipid modifications affecting membrane anchoring

  • Oligomerization states affecting enzymatic activity

  • Interactions with regulatory proteins

Experimental Approaches:

  • Mass spectrometry to identify modifications on purified lspA

  • Site-directed mutagenesis of potentially modified residues

  • Activity assays comparing wild-type and mutation-mimicking variants

  • Structural studies of different lspA conformational states

Understanding these regulatory mechanisms could provide new insights into how C. felis adapts its lipoprotein processing during different stages of infection and in response to host defenses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.