Recombinant Chlamydophila felis Na (+)-translocating NADH-quinone reductase subunit F (nqrF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrF; CF0130; Na(+-translocating NADH-quinone reductase subunit F; Na(+-NQR subunit F; Na(+-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Chlamydia felis (strain Fe/C-56) (Chlamydophila felis)
Target Names
nqrF
Target Protein Sequence
MTWLSGLYFISIASLVFCVIGLILSGVILISRKLLVKIHPCKLKINNDDSLTKTVDSGHS LLSSLLDSGIPIPSPCGGKATCKQCKVKIVKGADQPLETDRATFSKRQLEQGWRLSCQTK VQHDMNLEIEERYLNASSWEGTVVSNDNVATFIKELVVSVSPEHPIPFKPGGYLQISVPA YKTNTSDWKQTMAPEYHSDWERFNLFNQIIDNSLLESGSANKAYSLASYPAELPVIKFNI RIATPPFINNAPSPNIPWGVCSSYIFSLKPGDKITVSGPYGESFMKENNRPLIFLIGGAG SSFGRSHILDLLLDKHSTRDITLWYGARSLKENIYQEEYEKLEKDFPNFHYHLVLSEPLA EDIASGWDKNDPEKTNFLFRAFELGQLSKLSNPEDYLYYVCGPPLHNSSILKLLDNYGVE RSSIILDDFGN
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol via two sequential reactions coupled with Na+ ion transport from the cytoplasm to the periplasm. The initial step is catalyzed by NqrF, which accepts electrons from NADH and reduces ubiquinone-1 to ubisemiquinone through a one-electron transfer mechanism.
Database Links

KEGG: cfe:CF0130

STRING: 264202.CF0130

Protein Families
NqrF family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Na(+)-translocating NADH-quinone reductase subunit F (nqrF) in Chlamydophila felis and what is its significance?

The Na(+)-translocating NADH-quinone reductase subunit F (nqrF) is a bacterial protein component of the NQR complex that functions in electron transport and energy metabolism in Chlamydophila felis (now reclassified as Chlamydia felis). This protein participates in the Na(+)-pumping NADH:quinone oxidoreductase system, which is involved in electron transfer and sodium translocation across bacterial membranes .

The nqrF gene (also designated as CF0130 in the C. felis genome) encodes a 431-amino acid protein that is part of the energy metabolism pathway in this obligate intracellular pathogen . The significance of this protein lies in its central role in chlamydial energy production, which is critical for understanding how these obligate intracellular bacteria generate energy during different stages of their developmental cycle.

What is the genomic context of the nqrF gene in C. felis and why is it important for researchers?

The nqrF gene in C. felis is located in a genomically significant region. Specifically, the nucleotide sequence between the 5S rRNA gene (rrn) and the nqrF gene represents an area of considerable genomic plasticity within the Chlamydiaceae family . This region exhibits varied lengths and gene contents across different chlamydial species.

Research has revealed that the rrn-nqrF intergenic segment shows significant genomic variation among chlamydial strains. Notably, analysis of 45 chlamydial strains from nine species demonstrated this segment is a potential "hot spot" for gene recombination . Evidence suggests that genetic exchange has occurred at this site between C. felis, C. psittaci, and C. abortus, indicating horizontal gene transfer events that may influence bacterial evolution and adaptation .

This genomic context makes the nqrF gene and its surrounding region particularly valuable for researchers studying:

  • Chlamydial evolution and speciation

  • Mechanisms of horizontal gene transfer

  • Genomic plasticity in obligate intracellular bacteria

  • Evolutionary relationships among Chlamydiaceae

How is recombinant C. felis nqrF typically produced for research applications?

Recombinant C. felis nqrF protein is typically produced using Escherichia coli expression systems. The methodological approach typically follows these steps:

  • Gene cloning: The nqrF gene (coding for all 431 amino acids or partial sequences) is amplified from C. felis genomic DNA (typically strain Fe/C-56) and cloned into an appropriate expression vector.

  • Affinity tag addition: A His-tag is commonly added to the N-terminus of the protein to facilitate purification .

  • Expression conditions: The recombinant protein is expressed in E. coli under controlled conditions that optimize protein folding and minimize inclusion body formation.

  • Protein purification: The protein is typically purified using nickel affinity chromatography, leveraging the His-tag.

  • Storage preparation: The purified protein is formulated in a Tris-based buffer with approximately 50% glycerol to maintain stability . This preparation helps prevent protein degradation and maintains functionality.

The resulting recombinant protein can achieve purity levels of >85% by SDS-PAGE analysis, making it suitable for various research applications .

What are the optimal storage and handling conditions for recombinant nqrF protein to maintain its integrity?

Maintaining the integrity of recombinant nqrF protein requires specific storage and handling conditions. Based on manufacturer recommendations and research protocols, the following guidelines should be followed :

Storage conditions:

  • Store at -20°C for short-term or -80°C for extended storage

  • Formulate in a Tris-based buffer containing 50% glycerol as a cryoprotectant

  • Aliquot the protein solution before freezing to avoid multiple freeze-thaw cycles

Handling recommendations:

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • For reconstitution of lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

Shelf-life considerations:

  • Liquid formulations typically maintain stability for approximately 6 months at -20°C/-80°C

  • Lyophilized preparations have an extended shelf life of approximately 12 months at -20°C/-80°C

These storage and handling protocols are essential for maintaining the structural integrity and functional activity of the protein for research applications.

What is the role of nqrF in chlamydial energy metabolism and how does it relate to the developmental cycle?

The nqrF protein plays a critical role in the energy metabolism of Chlamydia felis as part of the Na(+)-pumping NADH:quinone oxidoreductase (Na(+)-NQR) complex. This complex is involved in:

  • Electron transport: nqrF facilitates the transfer of electrons from NADH to quinones in the bacterial respiratory chain .

  • Sodium translocation: The complex generates a sodium gradient across the cell membrane that can be used for energy conservation.

  • ATP generation: The sodium gradient created can be utilized for ATP synthesis through secondary transporters or ATP synthases.

Recent research has challenged traditional views of chlamydial metabolism by suggesting that even elementary bodies (EBs), previously thought to be metabolically inert, exhibit metabolic activity under appropriate conditions . The Na(+)-NQR complex, including nqrF, may be involved in this unexpected metabolic activity of EBs, which is potentially required for extracellular survival and maintenance of infectivity.

Throughout the developmental cycle, energy metabolism requirements change as Chlamydia transitions between reticulate bodies (RBs) and elementary bodies (EBs). The nqrF protein may play different roles in these stages:

  • In metabolically active RBs: Fully engaged in energy production

  • In transition to EBs: Potentially downregulated as metabolism decreases

  • In EBs: May maintain minimal functionality for survival outside host cells

These stage-specific metabolic adaptations, possibly involving regulated activity of the Na(+)-NQR complex, may contribute to the pathogen's ability to survive in diverse environments and maintain infectivity .

How can researchers utilize recombinant nqrF in studies of chlamydial pathogenesis and host-pathogen interactions?

Recombinant nqrF protein offers several research applications for investigating chlamydial pathogenesis and host-pathogen interactions:

  • Immunological studies:

    • Generation of specific antibodies against nqrF for immunolocalization studies

    • Analysis of host immune responses to this bacterial protein

    • Investigation of whether nqrF triggers specific pattern recognition receptors

  • Protein-protein interaction analyses:

    • Identification of host cell proteins that interact with nqrF

    • Characterization of other bacterial proteins that form complexes with nqrF

    • Determination of whether nqrF interacts with host mitochondrial proteins to influence energy metabolism

  • Structure-function studies:

    • Site-directed mutagenesis to identify critical residues

    • Crystallization attempts to determine three-dimensional structure

    • Biophysical characterization of enzyme activity under various conditions

  • Metabolic pathway reconstruction:

    • Use of purified recombinant nqrF to reconstruct in vitro electron transport systems

    • Analysis of kinetic parameters of electron transfer

    • Comparison with homologous proteins from other species

  • Drug development targets:

    • Screening of small molecule inhibitors against nqrF activity

    • Structure-based drug design targeting specific domains

    • Evaluation of species-specific inhibitors for therapeutic potential

Researchers can employ approaches such as co-immunoprecipitation, yeast two-hybrid screening, bacterial two-hybrid systems, or protein arrays to identify potential interacting partners of nqrF, providing insights into its functional networks within the bacterial cell and during host cell infection.

What genomic evidence suggests horizontal gene transfer involving the nqrF region in Chlamydiaceae?

Several lines of genomic evidence support horizontal gene transfer (HGT) events involving the nqrF region in Chlamydiaceae:

  • Sequence divergence patterns: Despite C. felis strains Fe/C-56 and FEPN Baker having almost identical rRNA sequences (>99.9% similarity), their rrn-nqrF intergenic segments show nearly 40% divergence . This pattern is inconsistent with standard evolutionary rates and suggests different evolutionary histories for these regions.

  • Cross-species sequence alignment: The rrn-nqrF intergenic segments from different C. felis strains align with those of C. psittaci and C. abortus, respectively, indicating genetic exchange between these species .

  • Recombination vestiges: The presence of an 89-bp sequence nearly identical to a chlamydial 23S rRNA domain 1 sequence flanking another gene (ilp) in the same region in C. caviae may represent a vestige of a previous horizontal transfer event .

  • Inconsistent phylogenetic signals: The variation in the rrn-nqrF intergenic segments is inconsistent with host range, tissue tropism, DNA-based phylogenies, and disease spectrum, suggesting this variation arose through horizontal transfer rather than vertical inheritance .

  • Recombination hot spot characteristics: The 5'-TGCTTTAG-3' octamer occurs at a higher frequency in this region than would be expected randomly in chlamydial genomes, similar to previously reported "Chi" recombination hot spots in other bacteria .

These findings collectively suggest that the region containing the nqrF gene has been subject to horizontal gene transfer events during chlamydial evolution, potentially contributing to adaptive processes in these organisms.

What experimental approaches can be used to study nqrF-mediated electron transport in obligate intracellular pathogens?

Studying electron transport systems in obligate intracellular pathogens like C. felis presents unique challenges due to their growth requirements. Here are methodological approaches researchers can employ:

  • Cell-free enzyme activity assays:

    • Measure NADH oxidation rates using purified recombinant nqrF

    • Determine quinone reduction kinetics with various electron acceptors

    • Assess Na+ transport using ion-sensitive fluorescent probes

  • Reconstitution systems:

    • Incorporate purified nqrF into proteoliposomes

    • Measure electron transport and ion translocation in a controlled environment

    • Test the effects of inhibitors and environmental conditions

  • Molecular genetics approaches:

    • Create conditional mutants of nqrF using inducible systems

    • Develop fluorescent reporter systems linked to nqrF expression

    • Express C. felis nqrF in heterologous bacterial systems for functional studies

  • Advanced imaging techniques:

    • Use electron microscopy with immunogold labeling to localize nqrF in bacterial cells

    • Apply super-resolution microscopy to visualize nqrF complexes

    • Utilize Förster Resonance Energy Transfer (FRET) to study protein-protein interactions

  • Electrochemical methods:

    • Employ potentiometric measurements to assess electron transfer activities

    • Use protein film voltammetry to study the electrochemical properties of nqrF

    • Develop bioelectrochemical systems to monitor real-time electron transport

  • Metabolic analyses:

    • Use stable isotope labeling to track metabolic fluxes influenced by nqrF

    • Apply metabolomics to identify metabolites affected by nqrF activity

    • Measure ATP production under various conditions to assess energy coupling

These experimental approaches can be combined to build a comprehensive understanding of nqrF function in the context of chlamydial energy metabolism, despite the challenges of working with obligate intracellular organisms.

What comparative genomic approaches can be used to understand the evolution of nqrF across chlamydial species?

Understanding the evolution of nqrF across chlamydial species requires sophisticated comparative genomic approaches:

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on nqrF sequences from various chlamydial species

    • Compare nqrF-based trees with those based on other genes (e.g., 16S rRNA) to identify incongruence that may indicate horizontal gene transfer

    • Use statistical methods like likelihood ratio tests to evaluate evolutionary models

  • Synteny analysis:

    • Examine gene arrangement around nqrF across chlamydial genomes

    • Identify conserved and variable regions in the genomic neighborhood

    • Map structural variations such as insertions, deletions, and rearrangements

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine whether nqrF is under purifying, neutral, or positive selection

    • Identify specific codons under different selection pressures

    • Correlate selection patterns with functional domains of the protein

  • Intergenic region analysis:

    • Compare the variable rrn-nqrF intergenic region across multiple strains and species

    • Identify potential recombination breakpoints using methods like bootscan analysis

    • Analyze the 5'-TGCTTTAG-3' octamer distribution and its potential role as a recombination hotspot

  • Whole genome comparison:

    • Place nqrF evolution in the context of genome-wide evolutionary patterns

    • Identify other genomic regions showing similar evolutionary signatures

    • Determine whether nqrF evolution correlates with host adaptation or pathogenicity

  • Ancestral sequence reconstruction:

    • Infer ancestral nqrF sequences at key evolutionary nodes

    • Model the evolutionary trajectory of the protein

    • Identify critical mutations that may have affected function

  • Horizontal gene transfer detection:

    • Use algorithms specifically designed to detect HGT events

    • Analyze GC content, codon usage, and tetranucleotide frequencies around nqrF

    • Identify potential donor and recipient species in HGT events

These approaches can be applied to the genomic data from the 45 chlamydial strains representing nine species that have been analyzed for rrn-nqrF intergenic segment variation , providing a comprehensive picture of nqrF evolution in the context of chlamydial diversification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.