Recombinant Chlamydophila psittaci Sulfur-rich protein (srp)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydophila psittaci Sulfur-rich Protein (srp)

Recombinant Chlamydophila psittaci Sulfur-rich protein (srp) is a protein derived from the bacterium Chlamydophila psittaci, which is known to cause psittacosis, a zoonotic disease affecting humans and birds. This protein is produced through recombinant DNA technology, allowing for its expression in host organisms like Escherichia coli. The recombinant form of the protein facilitates detailed studies on its structure, function, and potential applications in biomedical research.

Characteristics of Recombinant Chlamydophila psittaci Sulfur-rich Protein (srp)

  • Expression and Purification: The recombinant protein is typically expressed in E. coli and purified using affinity chromatography, often with a His-tag for easier purification .

  • Sequence and Structure: The protein consists of 160 amino acids, with a specific sequence that includes regions rich in sulfur-containing amino acids, hence its name .

  • Storage and Handling: It is stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability. Repeated freezing and thawing should be avoided .

Table 1: Characteristics of Recombinant Chlamydophila psittaci Sulfur-rich Protein (srp)

CharacteristicDescription
SpeciesChlamydophila psittaci (strain ATCC VR-125 / 6BC)
Protein Length160 amino acids
TagHis-tag (for purification)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C, avoid repeated freezing/thawing

Table 2: Potential Applications and Research Directions

Application/DirectionDescription
Biomedical ResearchStudy of bacterial pathogenesis and immune evasion mechanisms
Diagnostic ToolsPotential use in developing diagnostic assays for psittacosis
Vaccine DevelopmentInvestigation into its role as a potential antigen for vaccine development

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
srp; CPSIT_0209; G5O_0211; Sulfur-rich protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Chlamydophila psittaci (strain ATCC VR-125 / 6BC) (Chlamydia psittaci)
Target Names
srp
Target Protein Sequence
MSGENANSIGSDVTSLIQPGLEQVMQDEGVQVSLINSVLGWCRVHIINPIKTSKIVQSRA FQITMVVLGIILLIAGLALTFVLQGQLGKNAFLFLIPAVIGLVKLLATSVCMEKPCTPEK WRLCKRLLATTEDILDDGQINQSNTIFTMNSSESTSASAS
Uniprot No.

Target Background

Database Links

KEGG: chb:G5O_0211

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.