Recombinant Chloranthus spicatus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chloranthus spicatus Apocytochrome f (petA)

Recombinant Chloranthus spicatus Apocytochrome f (petA) is a protein related to Chloranthus spicatus, a plant species within the Chloranthaceae family . Apocytochrome f is a component of the cytochrome b6f complex, which is essential for photosynthetic electron transfer in plants . The "recombinant" aspect indicates that this protein has been produced using recombinant DNA technology, involving the insertion of the gene encoding Apocytochrome f (petA) from Chloranthus spicatus into a host organism for expression and production .

Biological Significance of Apocytochrome f (petA)

Apocytochrome f (petA) is a critical component of the cytochrome b6f complex, which mediates electron transfer between Photosystem II and Photosystem I in the photosynthetic electron transport chain . This process is vital for converting light energy into chemical energy in plants.

Chloranthus spicatus: Genomic and Evolutionary Context

Chloranthus spicatus belongs to the Chloranthales, an early diverging lineage of angiosperms . Genomic studies of Chloranthus spicatus have provided insights into the evolution of mesangiosperms (flowering plants) . These studies reveal that Chloranthus spicatus has a highly conserved synteny with other angiosperms like Amborella and Vitis . The genome of Chloranthus spicatus is characterized by long genes and introns, with the long introns primarily attributed to the presence of repeated elements .

Recombinant Production and ELISA

Recombinant Apocytochrome f (petA) can be produced for various research and diagnostic applications. ELISA (Enzyme-Linked Immunosorbent Assay) kits utilizing Recombinant Chloranthus spicatus Apocytochrome f (petA) are developed for the detection and quantification of this protein .

Applications of Recombinant Chloranthus spicatus Apocytochrome f (petA)

The recombinant form of this protein can be utilized in several applications:

  • ELISA assays: For quantifying Apocytochrome f (petA) levels in Chloranthus spicatus or related species .

  • Phylogenetic studies: To understand the evolutionary relationships and diversification of Chloranthales and other angiosperms .

  • Photosynthesis research: To investigate the structure, function, and regulation of the cytochrome b6f complex .

6.1. Genomic Features of Chloranthus spicatus

FeatureDescription
Genome SizeCharacterized by long genes and long introns .
Intron LengthSignificantly longer introns compared to other angiosperms like Arabidopsis thaliana and Oryza sativa .
SyntenyHighly conserved synteny with Amborella trichopoda and Vitis vinifera, indicating conserved genome structure .
Whole-Genome DuplicationEvidence of an ancient single whole-genome duplication event .

6.2. Comparative Genomics

Chloranthus spicatus shares a higher number of syntenic blocks with magnoliids compared to Ceratophyllales, Vitis vinifera, or Oryza sativa, indicating a closer evolutionary relationship with magnoliids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGALLILPEGFELAPPDRISPEMKEKMGNLSFQSYRPTKRNILVIGPVPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNARTAGIVS RIVRKEKGGYEITIADASDGHQVVDIIPSGPELLVSEGESIKLDQPLTSNPNVGGFGQGG AEIVLQDPLRVQGLLFFLASIILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Chloranthus spicatus Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is apocytochrome f and its function in Chloranthus spicatus?

Apocytochrome f refers to the precursor form of cytochrome f prior to heme attachment in Chloranthus spicatus. This protein, encoded by the petA gene, serves as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. In its mature form after heme attachment (holocytochrome f), it facilitates electron transfer between photosystem II and photosystem I.

The biosynthesis of functional cytochrome f involves multiple steps, including translation of the precursor protein, membrane targeting, processing of the signal sequence, and covalent ligation of a c-type heme group. Based on studies in other photosynthetic organisms, the precursor protein likely contains a signal sequence that targets it to the thylakoid membrane, where processing and heme attachment occur . The mature protein functions as an electron carrier with the heme group playing a central role in the redox activity.

While direct experimental data on Chloranthus spicatus cytochrome f is limited, comparative genomic analysis with the recently sequenced genome suggests conservation of key functional domains found in other plant species .

What is the structure and organization of the petA gene in Chloranthus spicatus?

The petA gene in Chloranthus spicatus is expected to be part of the highly conserved chloroplast genome. Based on synteny analysis of the C. spicatus genome with other angiosperms, the gene organization pattern is likely conserved, though with species-specific features .

From comparative analysis with other plant species like Synechococcus, we can infer that the petA gene in C. spicatus likely encodes a protein that includes:

  • A transit peptide (presequence) of approximately 40-50 amino acids for chloroplast targeting

  • A conserved CXXCH motif for heme binding in the mature protein

  • A hydrophobic C-terminal membrane anchor domain

Gene structure comparison with model organisms such as Synechococcus suggests that petA might be part of an operon structure, potentially co-transcribed with other photosynthetic components . The recent genome assembly of Chloranthus spicatus revealed significant conservation of syntenic blocks with other plant species, suggesting preservation of gene order and arrangement in key photosynthetic pathways .

How does Chloranthus spicatus apocytochrome f compare to that of other plant species?

Although specific sequence data for C. spicatus apocytochrome f is not directly provided in the search results, we can make informed comparisons based on evolutionary relationships and genome characteristics.

Chloranthus spicatus belongs to Chloranthales, a sister clade to magnoliids. Genome analysis shows that C. spicatus shares a high number of syntenic blocks (62.7%) with magnoliid species, suggesting significant conservation of genome structure . This conservation likely extends to important functional genes like petA.

A comparative table of cytochrome f characteristics across plant species:

SpeciesPresequence LengthMature Protein SizeHeme Binding DomainSequence Identity to C. spicatus (estimated)
Chloranthus spicatus~40-45 aa (predicted)~270-290 aa (predicted)CXXCH (predicted)100%
Synechococcus sp. PCC 700242 aa283 aaCANCHUnknown
Nostoc PCC 7906VariableVariableCXXCHUnknown
Higher plants (average)35-45 aa285-320 aaCXXCHLikely 60-75%

Notable differences in cyanobacterial cytochrome f compared to higher plants include charge distribution and pI, with cyanobacterial proteins typically having a more negative charge . Based on evolutionary relationships, C. spicatus cytochrome f likely shows intermediate characteristics between early-diverging angiosperms and more derived lineages.

What are the key domains and motifs in Chloranthus spicatus apocytochrome f?

Based on comparative analysis with cytochrome f from other plant species and cyanobacteria, the Chloranthus spicatus apocytochrome f likely contains several conserved domains and motifs essential for its function:

  • N-terminal transit peptide: Responsible for targeting the protein to the chloroplast and thylakoid membrane, typically 40-50 amino acids in length.

  • Heme-binding motif: A highly conserved CXXCH motif (likely CANCH based on comparison with other species) where covalent attachment of the heme group occurs through thioether bonds with the cysteine residues .

  • Axial ligand: As observed in crystallographic studies of cytochrome f from other species, the N-terminal amino acid (typically Tyrosine) of the mature protein likely serves as an axial ligand to the heme iron .

  • Membrane-spanning domain: A hydrophobic segment near the C-terminus that anchors the protein to the thylakoid membrane, typically 20-25 amino acids in length .

  • Charged interaction domains: Regions with distinctive charge distributions that facilitate interactions with electron transfer partners such as plastocyanin or cytochrome c .

Experimental analysis of conserved domains could be performed using multiple sequence alignment with cytochrome f sequences from related species, followed by predictive structure modeling to identify functionally important residues.

What are the optimal conditions for expressing recombinant Chloranthus spicatus apocytochrome f in bacterial systems?

Expression of recombinant C. spicatus apocytochrome f presents several challenges that require optimization:

Expression System Selection:

  • E. coli-based systems: BL21(DE3) or derivatives are commonly used, but may require co-expression of cytochrome c maturation (Ccm) proteins for proper heme attachment.

  • Alternative hosts: Consider Synechococcus or other cyanobacterial hosts which naturally possess the machinery for cytochrome f maturation.

Expression Construct Design:

  • Remove the chloroplast transit peptide sequence to improve expression.

  • Consider expressing a soluble form lacking the C-terminal membrane anchor.

  • Optimize codon usage for the expression host while maintaining critical functional regions.

Expression Conditions Protocol:

  • Transform expression plasmid into host cells.

  • Grow cultures at 28-30°C to OD600 of 0.6-0.8.

  • Induce with low IPTG concentration (0.1-0.5 mM) to minimize inclusion body formation.

  • Continue expression at reduced temperature (16-20°C) for 16-20 hours.

  • Supplement medium with δ-aminolevulinic acid (0.5 mM) to enhance heme biosynthesis.

  • Consider microaerobic conditions to prevent heme oxidation.

Optimization Table for Expression Parameters:

ParameterRange to TestMonitoring Method
Induction temperature16°C, 20°C, 25°CSDS-PAGE, Western blot
IPTG concentration0.1 mM, 0.3 mM, 0.5 mMSDS-PAGE, expression yield
Expression duration4h, 8h, 16h, 24hTime-course sampling
Media compositionLB, TB, M9, 2XYTGrowth curves, final yield
Heme precursorsNone, 0.5 mM ALA, 10 μM heminSpectroscopic analysis

The large genome size (2.97 Gb) and high repeat content (70.09%) of C. spicatus suggest possible challenges in expressing its genes in heterologous systems . Consider gene synthesis with optimized codons rather than direct amplification from genomic DNA.

How can site-directed mutagenesis be used to study the structure-function relationship of Chloranthus spicatus apocytochrome f?

Site-directed mutagenesis provides a powerful approach to investigate structure-function relationships in C. spicatus apocytochrome f. Similar to studies in other organisms like Chlamydomonas reinhardtii, this technique can reveal insights about protein processing, heme attachment, and electron transfer capabilities .

Key Residues for Mutagenesis:

  • Heme-binding cysteines: Substituting the conserved cysteines in the CXXCH motif with valine or leucine would prevent covalent heme attachment, allowing investigation of the relationship between heme binding and protein folding/stability .

  • Processing site residues: Modifying the consensus cleavage site for the thylakoid processing peptidase would help understand the relationship between precursor processing and heme attachment, similar to experiments where the AQA sequence was replaced with LQL in Chlamydomonas .

  • Axial ligand: Mutating the N-terminal residue of the mature protein (likely tyrosine) would disrupt heme coordination and affect electron transfer properties.

  • Charged residues: Altering residues in the nine domains that show differences in charged residues between cyanobacteria and plants would help elucidate their role in interactions with redox partners .

Experimental Protocol:

  • Design primers with desired mutations using overlap extension PCR.

  • Generate mutant constructs and confirm by sequencing.

  • Express wild-type and mutant proteins in parallel.

  • Analyze protein processing, heme incorporation, and structural features.

  • Assess functional properties through spectroscopic and kinetic measurements.

Expected Outcomes Table:

Mutation TypeExpected EffectAnalysis Methods
Heme-binding cysteines (C→V/L)Lack of heme incorporation, altered processingHeme staining, absorption spectroscopy, size analysis
Processing site (consensus→non-consensus)Delayed/altered processing, possible effects on heme attachmentImmunoblotting, pulse-chase analysis
Axial ligand (Y→F/A)Altered heme coordination, changed redox potentialEPR spectroscopy, redox titrations
Interface residues (charge reversals)Modified electron transfer kineticsFlash photolysis, stopped flow measurements

The insights from site-directed mutagenesis studies in other organisms suggest that processing of apocytochrome f and heme attachment may operate independently, as heme binding is not a prerequisite for cytochrome f processing .

What are the challenges in purifying functional recombinant Chloranthus spicatus apocytochrome f?

Purification of functional recombinant C. spicatus apocytochrome f presents several challenges that require careful experimental planning:

Major Purification Challenges:

  • Membrane protein solubilization: The C-terminal membrane anchor makes cytochrome f inherently hydrophobic. Consider expressing a truncated version lacking this domain, as has been done successfully with other cytochrome f proteins .

  • Maintaining heme attachment: The covalently attached heme can be sensitive to oxidative damage during purification. Include reducing agents (ascorbate, dithionite) in buffers to maintain the reduced state.

  • Proper folding: Ensuring correct folding is essential for function. The long introns characteristic of Chloranthus spicatus genes suggest complex regulation that may affect correct folding in heterologous systems .

  • Separating apo and holo forms: Incomplete heme incorporation leads to mixed populations of apo and holo forms that can be difficult to separate.

Purification Strategy:

  • Cell lysis: Gentle lysis methods to preserve protein integrity.

    • Enzymatic lysis with lysozyme (1 mg/ml) in hypotonic buffer

    • French press at moderate pressure (15,000 psi)

    • Avoid harsh detergents and excessive sonication

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using histidine tag.

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Mild detergent: 0.02% DDM or 0.5% CHAPS for membrane-anchored versions

    • Elution with 250 mM imidazole gradient

  • Secondary purification: Ion exchange chromatography to separate different forms.

    • For apocytochrome f: Q-Sepharose at pH 8.0

    • For holocytochrome f: Monitoring at 280 nm (protein) and 410 nm (heme)

  • Final polishing: Size exclusion chromatography

    • Buffer: 20 mM HEPES pH 7.5, 100 mM NaCl, 5% glycerol

    • Flow rate: 0.5 ml/min to maintain protein integrity

Troubleshooting Purification Issues:

IssuePossible CauseSolution
Poor yieldLow expression or protein degradationOptimize expression conditions, add protease inhibitors
Multiple peaks on SECAggregation or mixed oligomeric statesAdjust buffer conditions, try mild detergents
Low heme incorporationInefficient heme attachmentCo-express cytochrome c maturation proteins
Loss of activity during purificationOxidative damage to hemeInclude reducing agents in all buffers
Protein precipitationRemoval of stabilizing factorsInclude glycerol or mild detergents

When working with apocytochrome f, note that both the precursor and processed forms can bind heme and assemble into functional complexes, as demonstrated in studies with Chlamydomonas reinhardtii .

How does post-translational processing affect the functionality of recombinant Chloranthus spicatus apocytochrome f?

Post-translational processing is crucial for the functionality of recombinant C. spicatus apocytochrome f, involving two key events: precursor protein processing and heme attachment.

Precursor Processing:

The apocytochrome f precursor contains a transit peptide that is cleaved during maturation. Based on studies in other organisms, this processing is performed by the thylakoid processing peptidase which recognizes specific consensus sequences . The crystal structure of cytochrome f from other species reveals that the N-terminal amino acid generated upon cleavage of the signal sequence (typically tyrosine) serves as an axial ligand to the heme iron .

In heterologous expression systems, this processing may not occur correctly or completely. Experiments in Chlamydomonas where the consensus cleavage site was modified from AQA to LQL resulted in delayed processing but did not prevent heme binding or complex assembly . This suggests some flexibility in the processing requirements.

Heme Attachment:

Covalent attachment of heme to the CXXCH motif is catalyzed by a cytochrome c heme lyase. In recombinant systems, co-expression of the cytochrome c maturation (Ccm) proteins may be necessary for efficient heme attachment.

The relationship between these processes is complex but understanding their interplay is crucial:

  • Heme binding is not a prerequisite for cytochrome f processing, as shown by experiments where the cysteine residues responsible for heme binding were substituted .

  • Both precursor and processed forms can bind heme and assemble into functional complexes .

  • The correct conformation of pre-apocytochrome f is necessary for the cysteine residues to be substrates for the heme lyase .

Experimental Approach to Study Processing:

  • Pulse-chase analysis: Label newly synthesized proteins and track their processing over time.

  • Western blotting: Use antibodies specific to different regions to detect precursor and mature forms.

  • Mass spectrometry: Determine precise cleavage sites and potential modifications.

  • Spectroscopic analysis: Monitor heme incorporation through absorption spectra.

Processing Efficiency Table:

Construct DesignExpected ProcessingHeme IncorporationFunctional Assembly
Wild-type sequenceCompleteHighEfficient
Modified cleavage site (AQA→LQL)Delayed/PartialPossiblePossible
Cysteine mutants (C→V/L)NormalNoneImpaired
N-terminal mature residue mutantNormalAltered coordinationReduced function

The degradation of misfolded forms of cytochrome f involves a proteolytic system associated with the thylakoid membranes, and the C-terminal membrane anchor appears to down-regulate the rate of synthesis of cytochrome f , factors that should be considered when designing recombinant expression strategies.

What experimental approaches can be used to study the interaction between Chloranthus spicatus apocytochrome f and its redox partners?

Understanding the interactions between C. spicatus apocytochrome f and its redox partners is essential for characterizing its role in electron transport. Several experimental approaches can elucidate these interactions:

1. Co-Crystallization and Structural Analysis:

  • Express and purify both apocytochrome f and its putative redox partners (plastocyanin or cytochrome c6)

  • Perform co-crystallization trials at various protein ratios

  • Solve the complex structure using X-ray crystallography or cryo-EM

  • Identify key interaction residues at the protein-protein interface

2. Surface Plasmon Resonance (SPR):

  • Immobilize either cytochrome f or its redox partner on a sensor chip

  • Measure binding kinetics (kon and koff) at different ionic strengths

  • Determine binding affinity (KD) and thermodynamic parameters

  • Evaluate the effects of point mutations on binding parameters

3. Chemical Cross-linking Coupled with Mass Spectrometry:

  • Incubate cytochrome f with its redox partner in the presence of zero-length cross-linkers

  • Digest cross-linked complexes and analyze by LC-MS/MS

  • Identify cross-linked peptides to map interaction surfaces

  • Validate identified interactions through site-directed mutagenesis

4. Electron Transfer Kinetics:

  • Use laser flash photolysis to initiate electron transfer

  • Monitor the redox state changes of both proteins spectroscopically

  • Calculate electron transfer rates under various conditions

  • Determine the effects of ionic strength, pH, and temperature on kinetics

Interaction Analysis Protocol:

  • Express and purify recombinant C. spicatus cytochrome f

  • Identify potential redox partners based on genomic analysis

  • Perform preliminary binding studies using native gel electrophoresis

  • Conduct detailed kinetic and thermodynamic analyses

  • Validate physiological relevance through in vivo studies

Expected Interaction Parameters:

ParameterPlastocyanin InteractionCytochrome c InteractionMethod of Determination
Binding affinity (KD)1-10 μM (predicted)5-20 μM (predicted)SPR, ITC
Association rate (kon)10^6-10^8 M^-1s^-110^5-10^7 M^-1s^-1Flash photolysis, SPR
Electron transfer rate10^3-10^5 s^-110^3-10^4 s^-1Transient absorption spectroscopy
pH dependenceOptimal at pH 6-7Broader pH rangeActivity assays at varying pH

Based on comparisons with other cyanobacteria, the nine domains showing differences in charged residues between cyanobacteria and plants are likely involved in the ionic interactions with plastocyanin or cytochrome c-553, and warrant particular attention in interaction studies .

How can I troubleshoot issues with recombinant Chloranthus spicatus apocytochrome f expression and folding?

Troubleshooting expression and folding issues with recombinant C. spicatus apocytochrome f requires a systematic approach to identify and address specific problems:

Common Expression Issues and Solutions:

  • Low expression levels:

    • Cause: Codon bias, toxic effects, rapid degradation

    • Solutions:

      • Optimize codons for expression host

      • Use lower induction temperature (16-20°C)

      • Include protease inhibitors

      • Try different promoter strengths

  • Inclusion body formation:

    • Cause: Rapid expression, improper folding

    • Solutions:

      • Reduce induction level (0.1 mM IPTG)

      • Co-express molecular chaperones (GroEL/ES, DnaK/J)

      • Express as fusion with solubility tags (MBP, SUMO)

      • Try autoinduction media for gradual protein production

  • Incomplete heme incorporation:

    • Cause: Insufficient heme biosynthesis, improper folding

    • Solutions:

      • Supplement media with δ-aminolevulinic acid (ALA)

      • Co-express cytochrome c maturation proteins

      • Ensure reducing environment during expression

      • Express in hosts with native heme attachment machinery

Diagnostic Testing Protocol:

  • Expression analysis:

    • SDS-PAGE to verify protein size

    • Western blot with anti-His and anti-cytochrome f antibodies

    • Heme staining to distinguish apo and holo forms

  • Solubility assessment:

    • Fractionate cells into soluble and insoluble fractions

    • Analyze by SDS-PAGE and Western blot

    • Test different lysis and solubilization conditions

  • Functional analysis:

    • UV-visible spectroscopy (peaks at ~410 nm and ~550 nm indicate heme incorporation)

    • Reduction with dithionite to confirm functionality

    • Assess electron transfer capability with artificial donors/acceptors

Troubleshooting Decision Tree:

ObservationPossible CausesExperimental VerificationPotential Solutions
No protein detectedGene toxicity, rapid degradationTime-course sampling after induction, RT-PCRUse tightly controlled expression system, reduce temperature
Protein in inclusion bodiesMisfolding, overexpressionSolubility analysis of cell fractionsReduce expression rate, add folding enhancers
No heme incorporationImproper folding, insufficient hemeAbsorption spectroscopy, heme stainingSupplement with ALA, co-express Ccm proteins
Multiple protein formsIncomplete processingN-terminal sequencing, mass spectrometryEngineer construct without signal sequence
Aggregation during purificationHydrophobic interactions, oxidationSize exclusion chromatography, light scatteringAdd mild detergents, include reducing agents

It's worth noting that the long introns characteristic of Chloranthus spicatus genes are absent in recombinant expression constructs, which might affect protein folding compared to the native context. Additionally, genes with long introns in C. spicatus show distinct expression patterns , suggesting possible regulatory mechanisms that might be lost in recombinant systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.