Recombinant Chloranthus spicatus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit a is a core component of the Fo complex, forming a proton channel critical for ATP synthesis. Key functional roles include:

Proton Translocation

  • Subunit a interacts with subunit c (or equivalent) to create a proton pathway .

  • In bacterial systems, AtpI homologs (e.g., Bacillus pseudofirmus) stabilize the c-ring and facilitate rotor assembly .

Regulation and Redox Sensitivity

While subunit a lacks redox-active cysteines present in the γ subunit , it indirectly participates in regulatory mechanisms:

  • Light-dependent regulation: Altered proton motive force (pmf) modulates ATP synthase activity .

  • Metabolic regulation: ATP/ADP ratios and redox signals (e.g., thioredoxin) influence enzyme activity .

Genomic and Evolutionary Insights

The C. spicatus genome shares synteny with magnoliids, highlighting conserved ATP synthase subunit organization . Intronic LTRs contribute to long introns (e.g., AT1G04950.1 ortholog), suggesting TE-driven evolutionary divergence .

Experimental Models

  • Heterologous expression: The His-tagged recombinant protein enables structural studies of chloroplast ATP synthase subunit interactions .

  • Comparative studies: In Arabidopsis, γ subunit mutations disrupt redox regulation but not metabolic control , contrasting with bacterial AtpI roles .

Production and Purification

Recombinant atpI is produced via bacterial expression systems:

StepDetailsSource
CloningFull-length atpI gene cloned into expression vectors
Expression SystemE. coli BL21(DE3) or similar strains
PurificationNi-NTA affinity chromatography
Yield and PurityNot explicitly reported; inferred from standard protocols

Comparative Subunit Data

Chloranthus spicatus ATP synthase subunits include:

SubunitGene IDLengthFunctionSource
a (atpI)A6MMB0247 aaProton channel
β (atpB)A6MMC9507 aaCatalytic β subunit
c (atpH)A6MMA973 aaProton channel (c-ring)

Challenges and Future Directions

  • Structural resolution: Limited crystallographic data for plant ATP synthase subunits necessitate further studies.

  • Functional assays: Integration with CF1 subunits (e.g., γ, β) to reconstitute proton-driven ATP synthesis.

  • Evolutionary studies: Comparative analysis of atpI across Chloranthaceae to trace TE-driven intron expansion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
atpI
Target Protein Sequence
MNVLPCSINTLKVLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSATIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPRKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should recombinant Chloranthus spicatus ATP synthase subunits be stored and reconstituted for experimental use?

Recombinant ATP synthase subunits from C. spicatus are typically supplied as lyophilized powders and require specific handling for optimal activity:

Storage ConditionReconstitution ProtocolWorking Conditions
-20°C/-80°C upon receiptReconstitute in deionized sterile water (0.1-1.0 mg/mL)Store working aliquots at 4°C for up to one week
Aliquot for multiple useAdd 5-50% glycerol (50% recommended)Avoid repeated freeze-thaw cycles
Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0Briefly centrifuge prior to openingGreater than 90% purity by SDS-PAGE

For optimal experimental outcomes, after reconstitution, the protein solution should be aliquoted and stored with glycerol as a cryoprotectant. Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided .

What expression systems are most effective for producing recombinant C. spicatus ATP synthase subunits?

E. coli has proven to be the most effective heterologous expression system for C. spicatus ATP synthase subunits. The recombinant atpH protein is typically expressed with an N-terminal His-tag to facilitate purification through affinity chromatography . This approach yields protein with greater than 90% purity as determined by SDS-PAGE.

When expressing membrane proteins like ATP synthase subunits, several methodological considerations are critical:

  • Selection of appropriate E. coli strains optimized for membrane protein expression

  • Temperature optimization during induction (typically lower temperatures of 16-25°C)

  • Inclusion of chaperone co-expression plasmids to improve folding

  • Use of mild detergents for extraction and purification

  • Application of native-like lipid environments during reconstitution

These methodological refinements significantly improve the yield and functionality of recombinant ATP synthase subunits for downstream structural and functional studies.

How is ATP synthase activity regulated in response to environmental conditions in chloroplasts?

Chloroplast ATP synthase activity is dynamically regulated through multiple mechanisms that respond to environmental conditions:

  • Redox Regulation: The enzyme is regulated by modulation of a cysteine pair located in a regulatory loop in the γ-subunit. This regulation occurs through:

    • Light-induced electron flow from PSI through thioredoxin at high light

    • Chloroplast NAD(P)H: thioredoxin reductase C (NTRC) at low light

  • Metabolic Regulation: ATP synthase responds to metabolic demands:

    • Under low CO₂ availability, ATP synthase activity rapidly decreases

    • This slows proton efflux from the thylakoid lumen

    • Results in lumen acidification that triggers photoprotective responses

  • Environmental Stress Responses: Similar regulatory patterns occur under:

    • Drought stress conditions

    • Limitations in sink capacity at high CO₂ levels

This multi-layered regulation establishes a critical connection between the light reactions of photosynthesis and downstream carbon metabolism, allowing plants to adjust energetic outputs based on environmental conditions and metabolic needs.

How does ATP synthase modulation of the thylakoid proton motive force (pmf) affect photosynthetic regulation?

ATP synthase plays a central role in regulating photosynthesis through its effects on thylakoid proton motive force (pmf). This relationship involves sophisticated feedback mechanisms:

The pmf consists of two energetic components:

  • ΔpH: Proton concentration difference across the membrane

  • Δψ: Electric field from vectorial electron transfer

While both components drive ATP synthesis, the ΔpH specifically regulates:

Experimental evidence shows that under limited CO₂ availability, ATP synthase activity decreases, slowing proton efflux from the lumen. This acidifies the lumen, initiating downregulation of light reactions through qE activation and cytochrome b₆f complex limitation .

Researchers exploring this relationship should employ spectroscopic techniques to measure both components of pmf and correlate them with ATP synthase activity under various environmental conditions.

What can mutant studies reveal about ATP synthase function and regulation?

Targeted mutations in ATP synthase subunits provide powerful insights into functional mechanisms and regulatory pathways. The "cfq" mutant, containing a point mutation in the γ₁-subunit, demonstrates this approach:

ParameterWild Type Responsecfq Mutant Response
ATP synthase activity (gH⁺)NormalSignificantly faster
Response to lightRegulatedAltered regulation
Response to CO₂ levelsResponsiveAltered response
Response to fluctuating lightAdaptiveMaladaptive
Protein contentNormalLower than wild type
Specific activityNormalIncreased

Although the cfq mutation was expected to make ATP synthase more sensitive to oxidative down-regulation, experimental results showed increased activity . This apparent contradiction highlights the complexity of ATP synthase regulation and demonstrates how mutant studies can reveal unexpected insights.

The phenotypic similarities between cfq and pgr5 (proton gradient regulation 5) mutants suggest that PGR5 may function primarily in adjusting ATP synthase activity rather than regulating cyclic electron flow as previously thought . These findings demonstrate how targeted mutations can fundamentally reshape our understanding of photosynthetic regulation.

How do the genomic characteristics of Chloranthus spicatus influence ATP synthase gene expression and evolution?

The genomic context of ATP synthase genes in C. spicatus reveals important evolutionary insights:

  • Gene Structure: C. spicatus genes, including those encoding ATP synthase subunits, typically contain significantly longer introns than other angiosperms:

    • Average intron length in C. spicatus: 3,681 bp

    • Average intron length in Arabidopsis: 153 bp

    • Average intron length in Oryza: 372 bp

  • Evolutionary History: Genomic analysis provides evidence of a single ancient whole genome duplication (WGD) in C. spicatus:

    • Syntenic depth ratio between C. spicatus and Amborella trichopoda: 1:2

    • Syntenic depth ratio between C. spicatus and Vitis vinifera: 2:3

  • Genomic Synteny: C. spicatus shares significant syntenic conservation with other plant species:

    • 62.7% syntenic blocks shared with magnoliids

    • 52.5% syntenic blocks shared with Ceratophyllales

    • 56.5% syntenic blocks shared with Vitis vinifera

    • 45.3% syntenic blocks shared with Oryza sativa

These genomic characteristics have important implications for ATP synthase research in C. spicatus:

  • Longer introns may affect transcriptional regulation and processing

  • Ancient WGD suggests potential subfunctionalization or neofunctionalization of ATP synthase subunits

  • High syntenic conservation with magnoliids indicates evolutionary conservation of gene order in these lineages

Researchers studying ATP synthase expression should account for these genomic features when designing experiments and interpreting results.

What engineering approaches can be applied to modify ATP synthase function for enhanced photosynthetic efficiency?

Engineering ATP synthase offers promising avenues for improving photosynthetic efficiency. Current approaches include:

When engineering ATP synthase for enhanced photosynthetic efficiency, researchers must balance increased ATP production against the regulatory functions of the proton gradient, as disruption of thylakoid lumen acidification can impair photoprotection mechanisms .

How might comparative studies across Chloranthaceae family members advance ATP synthase research?

The genomic analysis of C. spicatus has revealed that an ancient whole genome duplication event is likely shared among all extant members of the Chloranthales clade, as evidenced by similar Ks distribution peaks in Ascarina rubricaulis, Chloranthus japonicus, and Sarcandra glabra . This presents a valuable opportunity for comparative studies of ATP synthase across this plant family.

Future research should:

  • Compare ATP synthase subunit sequences, structures, and functions across Chloranthaceae to identify conserved and divergent features

  • Investigate whether subfunctionalization or neofunctionalization of duplicated ATP synthase genes has occurred following the ancient WGD

  • Explore whether regulatory mechanisms of ATP synthase differ among Chloranthaceae members adapted to different ecological niches

  • Utilize the evolutionary diversity within this family to identify natural variants with enhanced ATP synthase performance

Such comparative approaches could reveal evolutionary adaptations in ATP synthase function that might inform engineering efforts for improved photosynthetic efficiency.

What is the relationship between ATP synthase activity and stress tolerance in Chloranthus spicatus?

Evidence suggests that ATP synthase regulation is key to stress tolerance in plants, with its activity decreased under drought stress and other environmental challenges . Future research should investigate:

  • Specific responses of C. spicatus ATP synthase to various abiotic stresses (drought, temperature extremes, light stress)

  • The role of ATP synthase regulation in balancing energy production against photoprotection during stress

  • Whether the unique genomic features of C. spicatus confer distinctive stress response mechanisms

  • The potential for engineering ATP synthase to enhance stress tolerance while maintaining photosynthetic efficiency

This research direction has significant implications for developing crops with improved resilience to environmental challenges in a changing climate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.