Recombinant Chloranthus spicatus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILVFLISGVLAPINEGPEKLSSYESGIEPMGNAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic and potentially chloroplast respiratory chains. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 in Chloranthus spicatus?

NAD(P)H-quinone oxidoreductase subunit 3 is a chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex (NDH complex) in Chloranthus spicatus. This protein is encoded by the chloroplast genome and serves as a critical component in chloroplastic electron transport. Similar to other NDH subunits, it likely participates in cyclic electron flow around photosystem I and chlororespiration. Based on homologous proteins in related species, this subunit contributes to the catalytic core of the complex responsible for electron transfer from NAD(P)H to plastoquinone .

The protein belongs to a family of enzymes classified under EC 1.6.5.-, which are also known as NAD(P)H dehydrogenases or NADH-plastoquinone oxidoreductases. Like other subunits in this complex, it possesses specific structural features that facilitate electron transport and integration within the thylakoid membrane system .

How does the structure of subunit 3 compare to other NDH subunits?

While specific structural information for subunit 3 is limited, comparisons with other characterized NDH subunits from Chloranthus spicatus reveal common patterns. For instance, like subunit 6 (ndhG), subunit 3 likely contains transmembrane domains that anchor it within the thylakoid membrane. The core structure would include regions involved in cofactor binding and electron transfer .

NDH subunits exhibit considerable variability in size, with subunit 2 (NdhB) having an apparent molecular weight of approximately 35 kDa, while subunit H (NdhH) appears at 45-49 kDa in electrophoretic analyses . Based on related NDH complexes, subunit 3 likely has a molecular weight between 30-40 kDa and contains multiple membrane-spanning regions critical for its function within the complex.

What are the optimal storage conditions for working with this recombinant protein?

For optimal preservation of recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase subunit 3, storage conditions should mirror those established for other subunits of this complex. The protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol, which helps prevent protein denaturation during freeze-thaw cycles .

For extended storage periods, conservation at -80°C is recommended to maintain protein integrity and enzymatic activity. Importantly, repeated freezing and thawing significantly compromises protein stability and should be avoided. When actively working with the protein, prepare small working aliquots and store them at 4°C for no longer than one week to minimize degradation .

Storage ConditionTemperatureMaximum DurationBuffer Composition
Long-term storage-80°CYearsTris-based buffer with 50% glycerol
Standard storage-20°CMonthsTris-based buffer with 50% glycerol
Working aliquots4°CUp to 1 weekTris-based buffer with 50% glycerol

What are effective methods for analyzing NAD(P)H-quinone oxidoreductase activity in chloroplast preparations?

To effectively analyze NAD(P)H-quinone oxidoreductase activity in chloroplast preparations containing subunit 3, researchers should employ a multi-faceted approach combining biochemical assays with immunological detection techniques.

Spectrophotometric enzyme activity assays can measure the oxidation of NAD(P)H in the presence of various quinone acceptors, providing quantitative data on enzyme kinetics. This approach typically monitors absorbance changes at 340 nm, corresponding to NAD(P)H oxidation. For more sensitive detection, researchers can employ fluorescence-based assays that monitor the decrease in NAD(P)H fluorescence during the reaction .

Immunological detection via Western blotting provides complementary information about protein expression levels. Based on protocols used for other NDH subunits, researchers should:

  • Precipitate total proteins from Chloranthus spicatus leaf tissue with 10% TCA and wash with acetone

  • Solubilize the proteins in a buffer containing 8M urea, 100 mM Tris-HCL pH 7.5, 1 mM EDTA, and 2% SDS

  • Separate proteins on a 4-20% gradient gel and transfer to PVDF membrane

  • Block with 8% milk in TTBS for 30 minutes at room temperature

  • Incubate with primary antibody at appropriate dilution (typically 1:1000 to 1:5000) overnight at 4°C

  • Wash thoroughly with TTBS and incubate with HRP-conjugated secondary antibody

  • Develop using enhanced chemiluminescence detection

How can I optimize the expression of recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase subunit 3?

Optimizing expression of recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase subunit 3 requires careful consideration of expression systems, codon optimization, and purification strategies. For heterologous expression, E. coli systems typically provide good yields, though eukaryotic systems like yeast or insect cells may better accommodate post-translational modifications.

When designing expression constructs, consider the following optimization strategies:

  • Codon optimization based on the Chloranthus spicatus genome, which has a size of 2.97 Gb and exhibits unique codon preferences that differ from model organisms

  • Inclusion of appropriate affinity tags (His, GST, or MBP) to facilitate purification while minimizing interference with protein folding and activity

  • Use of solubility-enhancing fusion partners if the protein exhibits poor solubility in initial expression trials

  • Expression temperature optimization, typically testing 16°C, 25°C, and 37°C to balance expression level with proper folding

  • Induction protocol optimization, testing various IPTG concentrations (0.1-1.0 mM) or auto-induction media formulations

Based on characteristics of similar NDH subunits, consider purification under native conditions if possible, though the membrane-associated nature of this protein may necessitate the use of detergents for extraction and purification .

What techniques are most effective for studying protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 3?

Studying protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 3 requires specialized techniques that accommodate the membrane-associated nature of this protein. The most effective approaches include:

  • Co-immunoprecipitation (Co-IP) with antibodies against subunit 3, followed by mass spectrometry to identify interacting partners. This approach requires careful optimization of detergent conditions to maintain native interactions while solubilizing membrane complexes.

  • Proximity-based labeling techniques such as BioID or APEX2, where the protein of interest is fused to a promiscuous biotin ligase that biotinylates proximal proteins, allowing their subsequent identification.

  • Yeast two-hybrid (Y2H) membrane system variants that are specifically designed for membrane proteins, such as the split-ubiquitin Y2H system.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to preserve native protein complexes, followed by a second dimension SDS-PAGE to resolve individual components.

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for detecting interactions in vivo, though these require genetic modification of the host organism.

When designing these experiments, consider that NDH complexes in chloroplasts typically contain multiple subunits and interact with other components of the photosynthetic apparatus, particularly those involved in cyclic electron flow around photosystem I .

How does the amino acid sequence of Chloranthus spicatus NAD(P)H-quinone oxidoreductase subunit 3 compare to homologous proteins in other plant species?

The amino acid sequence of NAD(P)H-quinone oxidoreductase subunit 3 in Chloranthus spicatus likely shows significant conservation with homologous proteins in other plant species, particularly in functional domains involved in electron transport and cofactor binding. While specific sequence data for subunit 3 is not provided in the search results, analysis of other NDH subunits suggests patterns of evolutionary conservation.

Based on the genome sequencing data for Chloranthus spicatus and comparative analyses of other NDH subunits, we can infer that subunit 3 likely exhibits:

  • High sequence conservation in core functional domains across angiosperms

  • Greater divergence in regions not directly involved in electron transport

  • Unique sequence features that reflect the early divergence of Chloranthales in angiosperm evolution

From evolutionary analyses of the Chloranthus genome, this species represents an important lineage for understanding the early diversification of flowering plants. The Chloranthus spicatus genome size of 2.97 Gb and its heterozygosity rate of 0.99% provide context for understanding the evolution of chloroplast genes including those encoding NDH complex components .

What role does NAD(P)H-quinone oxidoreductase subunit 3 play in cyclic electron transport and photoprotection?

NAD(P)H-quinone oxidoreductase subunit 3 likely plays a critical role in cyclic electron transport around photosystem I and contributes to photoprotection mechanisms in Chloranthus spicatus. As a component of the chloroplastic NDH complex, this subunit participates in processes that help plants adapt to fluctuating light conditions and environmental stresses.

The NDH complex facilitates cyclic electron flow, which generates additional ATP without producing NADPH, thereby balancing the ATP/NADPH ratio required for Calvin cycle operations. This process becomes particularly important under stress conditions such as high light, drought, or temperature extremes. Additionally, the NDH complex contributes to chlororespiration, a respiratory electron transport pathway in chloroplasts that operates in darkness.

Research into other NDH subunits suggests that subunit 3 likely contributes to:

  • Assembly and stability of the NDH complex within thylakoid membranes

  • Electron transfer from stromal electron donors to the plastoquinone pool

  • Regulation of cyclic electron flow in response to changing environmental conditions

  • Protection against photoinhibition under high light conditions

Understanding these functions has significant implications for studying plant adaptation to environmental stresses and potential applications in improving crop resilience to climate change.

How can structural biology approaches advance our understanding of NAD(P)H-quinone oxidoreductase subunit 3?

Structural biology approaches offer powerful tools for elucidating the function and interactions of NAD(P)H-quinone oxidoreductase subunit 3. These methodologies can reveal atomic-level details about protein structure, cofactor binding, and interaction interfaces that are crucial for understanding enzymatic mechanisms.

For membrane proteins like NDH subunits, cryo-electron microscopy (cryo-EM) has emerged as a particularly valuable technique. Unlike X-ray crystallography, which requires crystallization of the protein, cryo-EM can resolve structures of membrane protein complexes in near-native environments. This approach could:

  • Determine the position and orientation of subunit 3 within the larger NDH complex

  • Identify critical residues involved in electron transfer pathways

  • Reveal conformational changes associated with enzyme catalysis

  • Clarify interaction surfaces with other subunits and photosynthetic components

Molecular dynamics simulations can complement experimental structural data by modeling protein dynamics within the membrane environment. These simulations can predict how subunit 3 responds to changing conditions, providing insights into regulatory mechanisms and potential targets for functional studies .

The recent assembly of the high-quality chromosome-level genome for Chloranthus spicatus provides valuable sequence information that can inform structural predictions and experimental design for structural biology studies of this important protein .

What are common challenges in purifying recombinant NAD(P)H-quinone oxidoreductase subunit 3, and how can they be addressed?

Purification of recombinant NAD(P)H-quinone oxidoreductase subunit 3 presents several challenges due to its membrane-associated nature. Common issues include poor solubility, loss of activity during purification, and co-purification of contaminants. Below are effective strategies to address these challenges:

Challenge: Poor solubility

  • Solution: Optimize detergent selection by screening multiple detergents (DDM, LMNG, digitonin) at various concentrations to find conditions that effectively solubilize the protein while maintaining its native structure

  • Alternative approach: Design constructs that exclude highly hydrophobic regions while retaining functional domains for soluble expression

Challenge: Low expression levels

  • Solution: Test multiple expression systems including specialized E. coli strains (C41/C43), yeast systems, or insect cell expression platforms that are better equipped for membrane protein expression

  • Optimization: Adjust growth temperature (typically lowering to 16-20°C), induction conditions, and media composition to enhance expression

Challenge: Protein instability during purification

  • Solution: Include appropriate protease inhibitors and stabilizing agents (glycerol, specific lipids) in all buffers

  • Approach: Minimize purification steps and handling time, maintaining cold temperatures throughout the process

Challenge: Co-purification of contaminants

  • Solution: Implement multi-step purification strategies including initial affinity chromatography followed by ion exchange and/or size exclusion chromatography

  • Verification: Use Western blot analysis with specific antibodies to confirm identity and purity of the target protein

How can I verify the functional integrity of purified recombinant NAD(P)H-quinone oxidoreductase subunit 3?

Verifying the functional integrity of purified recombinant NAD(P)H-quinone oxidoreductase subunit 3 is essential for subsequent experimental applications. Multiple complementary approaches should be employed:

Enzymatic Activity Assays:

  • Measure NAD(P)H oxidation rates spectrophotometrically at 340 nm using various quinone acceptors

  • Calculate kinetic parameters (Km, Vmax) and compare with values for native enzyme when available

  • Assess inhibitor sensitivity using known inhibitors of the NDH complex

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Thermal shift assays to determine protein stability under various conditions

  • Size exclusion chromatography to confirm proper oligomeric state

Functional Reconstitution:

  • Reconstitute the purified protein into proteoliposomes

  • Measure electron transport activities in the reconstituted system

  • Compare functional properties with those of native membranes

Interaction Analysis:

  • Verify binding to known interaction partners using pull-down assays

  • Assess incorporation into partial or complete NDH complexes

  • Evaluate cofactor binding using spectroscopic methods

When interpreting results, remember that the isolated subunit may display different properties compared to the intact NDH complex. Whenever possible, complementary functional assays in native systems should be performed to validate findings from recombinant protein studies.

What considerations are important when designing antibodies against NAD(P)H-quinone oxidoreductase subunit 3?

Designing effective antibodies against NAD(P)H-quinone oxidoreductase subunit 3 requires careful consideration of several key factors to ensure specificity, sensitivity, and utility in various applications:

Epitope Selection:

  • Identify unique, surface-exposed regions specific to subunit 3 using sequence alignment tools

  • Prioritize regions with low sequence conservation among other NDH subunits to minimize cross-reactivity

  • Avoid transmembrane domains, which are often inaccessible and can lead to non-specific hydrophobic interactions

Peptide Design for Immunization:

  • Select peptides of 10-20 amino acids in length

  • Ensure the selected peptide has good antigenic properties using prediction algorithms

  • Consider conjugation to carrier proteins like KLH (keyhole limpet hemocyanin) to enhance immunogenicity, similar to the approach used for NdhB and NdhH antibodies

Antibody Validation Strategy:

  • Test antibody specificity against recombinant protein and total protein extracts

  • Perform preabsorption controls with immunizing peptide

  • Include appropriate positive controls (tissues known to express the protein) and negative controls (knockout or low-expression tissues)

  • Validate across multiple applications (Western blot, immunoprecipitation, immunohistochemistry) as needed

Based on successful strategies used for other NDH subunits, researchers should consider developing polyclonal antibodies in rabbits, with affinity purification against the immunizing peptide to enhance specificity. The expected dilution range for Western blot applications would likely be between 1:1000 and 1:5000, similar to antibodies developed against NdhB (1:1000) and NdhH (1:5000) .

How can comparative genomics advance our understanding of NAD(P)H-quinone oxidoreductase evolution?

Comparative genomics approaches provide powerful tools for understanding the evolution and functional significance of NAD(P)H-quinone oxidoreductase subunit 3 in Chloranthus spicatus and across plant lineages. The recent sequencing of the Chloranthus spicatus genome (2.97 Gb) creates new opportunities for evolutionary analyses of chloroplast-encoded proteins .

Researchers can implement the following analytical approaches:

  • Phylogenetic analysis of NDH subunit sequences across diverse plant lineages to reconstruct evolutionary relationships and identify conserved functional domains

  • Selection pressure analysis using dN/dS ratios to identify sites under positive, neutral, or purifying selection, revealing functionally critical residues

  • Synteny analysis of chloroplast genomes to understand the genomic context and evolutionary history of ndh genes

  • Co-evolution analysis to identify correlated evolutionary patterns between different NDH subunits, potentially revealing functional interactions

The Chloranthus genome provides a particularly valuable reference point as it represents an early-diverging lineage of mesangiosperms. Comparative analyses including this genome can offer insights into the ancestral state of NDH complexes in flowering plants and the subsequent diversification of these important photosynthetic components .

When conducting these analyses, researchers should consider that repetitive elements account for 70.09% of the Chloranthus spicatus genome, with LTR retrotransposons being particularly abundant (58.79% of the genome) . This genomic context may influence the evolution of nuclear-encoded factors that interact with chloroplast-encoded NDH subunits.

What bioinformatic tools are most useful for analyzing NAD(P)H-quinone oxidoreductase function across species?

For comprehensive analysis of NAD(P)H-quinone oxidoreductase subunit 3 function across species, researchers should employ a multi-faceted bioinformatic approach combining several specialized tools:

Sequence Analysis Tools:

  • BLAST and HMMER for identifying homologous sequences across diverse species

  • MUSCLE, MAFFT, or Clustal Omega for multiple sequence alignment

  • Jalview or AliView for alignment visualization and analysis

  • MEGA or RAxML for phylogenetic tree construction

Structural Prediction Tools:

  • AlphaFold2 or RoseTTAFold for protein structure prediction

  • TMHMM or TOPCONS for transmembrane domain prediction

  • ConSurf for mapping conservation onto predicted structures

  • COACH or 3DLigandSite for ligand binding site prediction

Functional Analysis Tools:

  • InterProScan for domain and motif identification

  • STRING or BioGRID for protein-protein interaction network analysis

  • KEGG or BioCyc for metabolic pathway mapping

  • TargetP or Predotar for subcellular localization prediction

When implementing these tools for Chloranthus spicatus NAD(P)H-quinone oxidoreductase analysis, researchers should incorporate data from the recently sequenced Chloranthus genome and consider the evolutionary position of this species as an early-diverging mesangiosperm lineage .

The analysis should focus particularly on conserved residues that may be involved in electron transfer, quinone binding, or subunit interactions. Comparative analysis with bacterial NDH homologs (Complex I) can provide additional insights into fundamental mechanistic aspects of these enzymes.

How can I integrate transcriptomic and proteomic data to understand NDH complex regulation in Chloranthus spicatus?

Integrating transcriptomic and proteomic data provides a comprehensive view of NDH complex regulation in Chloranthus spicatus, revealing mechanisms controlling expression, assembly, and function of NAD(P)H-quinone oxidoreductase subunit 3 and related components. This multi-omics approach can uncover regulatory networks responding to environmental conditions and developmental stages.

Experimental Design Considerations:

  • Collect matched samples for both transcriptomic and proteomic analyses

  • Include diverse environmental conditions (high/low light, drought, temperature stress)

  • Sample multiple developmental stages

  • Consider diurnal time points to capture circadian regulation

Integration Methodology:

  • Co-expression network analysis to identify genes with expression patterns correlated with NDH subunits

  • Protein-protein interaction mapping through AP-MS (affinity purification-mass spectrometry) or BioID approaches

  • Pathway enrichment analysis to identify biological processes coordinated with NDH complex regulation

  • Transcription factor binding site analysis to identify potential regulators of NDH gene expression

Analysis Framework:

  • Normalize and transform transcriptomic and proteomic data appropriately

  • Calculate correlation coefficients between transcript and protein abundance

  • Apply machine learning approaches (e.g., random forest, support vector machines) to identify key regulatory factors

  • Validate predictions through targeted experiments (ChIP-seq, reporter assays, etc.)

When implementing this approach, researchers should consider that the Chloranthus spicatus genome contains a high proportion of repetitive elements (70.09%) that may complicate genomic analyses . Additionally, the obligate outcrossing system of this species, reflected in its heterozygosity rate of 0.99%, may introduce genetic variation that should be considered when analyzing regulatory patterns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.