Recombinant Chloranthus spicatus NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Functional Role and Enzymatic Classification

Recombinant subunit 4L is part of the NDH complex, a chloroplast homolog of mitochondrial complex I. It participates in:

  • NAD(P)H-Plastoquinone Oxidoreductase Activity: Facilitates electron transfer from NAD(P)H to plastoquinone, contributing to proton translocation and ATP synthesis in cyclic electron flow .

  • Proton Translocation: Linked to proton pumping across the thylakoid membrane, critical for maintaining the proton gradient in photosynthesis .

Enzyme Classification:

  • EC Number: 1.6.5.- (NAD(P)H:quinone oxidoreductase) .

  • Superfamily: FMN-dependent oxidoreductases, sharing structural and functional homology with azoreductases and bacterial NAD(P)H-quinone oxidoreductases .

Biotechnological Production

The recombinant protein is produced in E. coli for research and diagnostic purposes, including:

  • ELISA Assays: Used as a standard in enzyme-linked immunosorbent assays to study subunit-specific interactions or antibody validation .

  • Structural Studies: While structural data for Chloranthus spicatus subunit 4L is limited, homologs (e.g., Hordeum vulgare) have been studied via cryo-EM, revealing interactions within the NDH complex .

Functional Insights

  • Electron Transport: Subunit 4L interacts with other NDH subunits (e.g., F, 6, H, I) to form a membrane-bound complex, enabling quinone reduction and proton pumping .

  • Redundancy in Photosynthesis: In some plants, NDH complexes may compensate for cyclic electron flow under stress conditions, though subunit 4L’s specific role remains under investigation .

Comparative Analysis with Related Proteins

PropertyChloranthus spicatus Subunit 4LHordeum vulgare Subunit 4L
Source OrganismChloranthus spicatusHordeum vulgare (barley)
Molecular Weight~11.2 kDa (estimated)11.2 kDa (theoretical)
Subunit InteractionsPart of NDH complexPart of NDH complex
Structural DataLimitedCryo-EM resolved

Challenges and Future Directions

  • Stability Issues: Recombinant subunit 4L requires strict storage protocols to prevent aggregation, limiting its use in long-term studies .

  • Functional Studies: Further research is needed to elucidate its role in stress adaptation and interactions with other subunits in the NDH complex.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them in your order. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery time information.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIHRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) is an enzyme that shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase in chloroplasts functions as a key component in the redox regulatory network, catalyzing the reduction of quinone molecules using NAD(P)H as an electron donor. This enzyme plays a critical role in maintaining redox homeostasis within the chloroplast by:

  • Participating in electron transfer chains that help dissipate excess reducing equivalents under high irradiance conditions

  • Contributing to the chloroplast's antioxidant defense system

  • Potentially functioning in the coordination between photochemical reactions and metabolic pathways

The enzyme operates within a complex redox regulatory network that includes other components such as thioredoxins (TRXs) and peroxiredoxins (PRXs). This network helps optimize the use of excitation energy at low irradiance and dissipate excess energy at high irradiance, a mechanism previously proposed as photosynthetic control .

Methodologically, studying the function of this enzyme requires techniques such as enzyme activity assays, redox state analysis, and measurement of NADPH/NADP+ ratios under various light conditions.

What expression systems are recommended for producing recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase?

The most validated expression system for this protein is Escherichia coli, as demonstrated in current research protocols . When establishing an expression system, researchers should consider:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- High yield
- Cost-effective
- Rapid growth
- Well-established protocols
- Potential improper folding
- Lack of post-translational modifications
- Inclusion body formation
- Use specialized strains (e.g., BL21(DE3))
- Optimize codon usage
- Express with chaperones
- Lower induction temperature
Insect cells- Better folding for plant proteins
- Some post-translational modifications
- Higher cost
- Longer production time
- More complex setup
- Optimize infection MOI
- Screen multiple cell lines
- Co-express with folding factors
Plant expression systems- Native environment
- Correct post-translational modifications
- Lower yields
- Longer production time
- Use inducible promoters
- Optimize codon usage for host plant
- Consider chloroplast transformation

For functional studies, it's recommended to use N-terminal His-tag fusion constructs, which have been successfully employed without compromising the enzyme's activity .

What are the optimal storage and handling conditions for recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase?

Proper storage and handling of this recombinant protein are essential for maintaining its stability and enzymatic activity:

  • Initial storage: Store the lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage to prevent repeated freeze-thaw cycles

  • Working conditions:

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces activity

    • Buffer conditions for activity assays should maintain pH 8.0 (Tris/PBS-based buffer)

  • Activity preservation:

    • Addition of reducing agents (e.g., DTT or β-mercaptoethanol) at low concentrations may help preserve enzymatic activity

    • Consider adding protease inhibitors when working with cell extracts

How can researchers verify the purity and activity of recombinant Chloranthus spicatus NAD(P)H-quinone oxidoreductase?

Verification of protein purity and activity is a critical step before conducting functional studies:

Purity assessment methods:

  • SDS-PAGE analysis - The purified protein should show >90% purity with a single band at the expected molecular weight

  • Western blot analysis using anti-His antibodies (for His-tagged constructs)

  • Size exclusion chromatography to verify homogeneity and oligomeric state

Activity assays:

  • Spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm

  • Enzyme kinetics determination using varying concentrations of NAD(P)H and quinone substrates

  • Native gel activity staining using nitroblue tetrazolium

A typical activity assay protocol involves:

  • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl

  • Substrate: 100 μM NADPH or NADH

  • Electron acceptor: 50-100 μM quinone derivatives

  • Monitor decrease in absorbance at 340 nm over time

  • Calculate specific activity as μmol NAD(P)H oxidized/min/mg protein

How does NAD(P)H-quinone oxidoreductase contribute to redox homeostasis in chloroplasts?

NAD(P)H-quinone oxidoreductase plays a sophisticated role in maintaining redox homeostasis in chloroplasts through multiple interconnected mechanisms:

  • Electron dissipation pathway: The enzyme serves as part of an electron sink system that helps prevent over-reduction of the photosynthetic electron transport chain, particularly under high light conditions. This function is critical as it helps prevent formation of reactive oxygen species (ROS) when electron acceptors become limiting.

  • Integration with thiol-based redox systems: Current research indicates this enzyme likely operates in conjunction with the NTRC–2-Cys PRXs system, which facilitates the transfer of reducing equivalents to hydrogen peroxide. This system helps accelerate the oxidation of stromal enzymes in the dark and may serve as an important mechanism to dissipate excess reducing equivalents under high irradiance .

  • Regulation of NADPH/NADP+ ratio: By oxidizing NADPH, the enzyme helps maintain optimal NADPH/NADP+ ratios, which is essential for proper functioning of numerous chloroplast metabolic pathways. Research has shown that NADPH levels increase upon illumination and rapidly decrease in the dark, suggesting a regulatory role for enzymes that utilize NADPH .

  • Prevention of futile cycles: To prevent wasteful oxidation of NADPH in vivo, the activity of NAD(P)H-quinone oxidoreductase and related systems (like NTRC–2-Cys PRXs) must be tightly controlled. This regulation likely occurs through post-translational modifications or protein-protein interactions that adapt enzyme activity to prevailing conditions .

Experimental approaches to study these contributions include:

  • Using redox-sensitive GFP probes to monitor real-time changes in chloroplast redox state

  • Employing genetically encoded NADPH sensors to measure dynamic changes in NADPH levels

  • Analyzing mutant lines with altered expression of NAD(P)H-quinone oxidoreductase to assess impacts on redox homeostasis

What experimental approaches can be used to study interactions between NAD(P)H-quinone oxidoreductase and other chloroplast proteins?

Understanding protein-protein interactions is essential for elucidating the functional networks involving NAD(P)H-quinone oxidoreductase. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry:

    • Use antibodies against the recombinant NAD(P)H-quinone oxidoreductase or its His-tag

    • Identify interacting partners through LC-MS/MS analysis

    • Validate interactions with reciprocal Co-IP experiments

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of NAD(P)H-quinone oxidoreductase and potential partner proteins with split fluorescent protein fragments

    • Express in chloroplasts using appropriate targeting sequences

    • Visualize interactions through fluorescence microscopy

  • Thylakoid membrane co-fractionation:

    • Isolate intact chloroplasts and fractionate thylakoid membranes

    • Analyze co-migration patterns of NAD(P)H-quinone oxidoreductase with other proteins

    • Use blue native PAGE to preserve membrane protein complexes

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant NAD(P)H-quinone oxidoreductase on a sensor chip

    • Flow potential interacting proteins over the surface

    • Measure binding kinetics and affinities

Research has shown that chloroplast redox proteins often form regulatory networks - for example, 2-Cys PRXs interact with different proteins in the chloroplast stroma and could act as oxidant relays by direct interaction with these targets . Similar methodologies could identify partners of NAD(P)H-quinone oxidoreductase.

What is the evolutionary significance of NAD(P)H-quinone oxidoreductase in Chloranthus spicatus compared to other plant species?

The evolutionary trajectory of NAD(P)H-quinone oxidoreductase in Chloranthus spicatus presents a fascinating case study in plant molecular evolution:

  • Phylogenetic context: Chloranthus spicatus belongs to Chloranthales, considered one of the early-diverging angiosperm lineages (mesangiosperms). Genomic analysis reveals that Chloranthus spicatus shares more syntenic blocks (3,029; 62.7%) with magnoliids than with other plant groups like Ceratophyllales (2,483; 52.5%), Vitis vinifera (2,275; 56.5%), or the monocot Oryza sativa (1,700; 45.3%) .

  • Gene structure characteristics: Chloranthus spicatus exhibits distinctive genomic features that may influence its proteins' evolution:

    • Long genes are more prevalent in Chloranthus spicatus compared to other angiosperms

    • While coding region lengths are similar across plant species, Chloranthus spicatus has dramatically longer introns (average 3,681 bp) compared to Arabidopsis thaliana (153 bp) and Oryza sativa (372 bp)

    • This genomic architecture may facilitate alternative splicing and novel protein isoforms

  • Whole genome duplication (WGD) events: Analysis of synonymous substitution rates (Ks) distribution for Chloranthus spicatus paralogs shows a peak at approximately Ks = 0.9, suggesting an ancient WGD event shared among all extant members of Chloranthales . This event may have facilitated functional diversification of genes including those encoding redox proteins.

  • Methodological approaches for evolutionary analysis:

    • Construct phylogenetic trees using orthologous NAD(P)H-quinone oxidoreductase sequences

    • Calculate selection pressure (dN/dS ratios) to identify conserved functional domains

    • Perform ancestral sequence reconstruction to trace the evolutionary trajectory

    • Compare gene synteny across diverse plant species to understand genomic context evolution

Understanding the evolutionary history of this enzyme provides insights into adaptation mechanisms for chloroplast redox regulation across diverse plant lineages and environmental conditions.

How can researchers investigate the role of NAD(P)H-quinone oxidoreductase in response to environmental stress?

Investigating the role of NAD(P)H-quinone oxidoreductase in stress response requires a multi-faceted approach combining physiological, biochemical, and molecular techniques:

The chloroplast redox state functions as an important sensor of environmental conditions and serves as a source of retrograde signals that coordinate plant growth under varying conditions . NAD(P)H-quinone oxidoreductase likely participates in this sensing mechanism through its role in maintaining redox balance.

A powerful experimental design would involve:

  • Subjecting plants to controlled stress treatments (high light, drought, temperature)

  • Monitoring dynamic changes in enzyme activity, localization, and interaction partners

  • Correlating these molecular changes with physiological responses and plant performance

What are the technical challenges and solutions in purifying active NAD(P)H-quinone oxidoreductase for functional studies?

Purifying active NAD(P)H-quinone oxidoreductase presents several technical challenges due to its membrane association and redox sensitivity. Researchers should consider these challenges and potential solutions:

ChallengeCauseSolution Approaches
Low solubilityMembrane association- Use mild detergents (DDM, CHAPS)
- Engineer soluble variants
- Express without membrane-spanning regions
Loss of activity during purificationOxidation of critical thiols- Include reducing agents in buffers
- Perform purification under anaerobic conditions
- Add stabilizing agents like glycerol
Co-purification of contaminantsNon-specific binding- Implement two-stage purification
- Use size exclusion chromatography
- Consider on-column refolding
AggregationImproper folding- Optimize protein concentration
- Screen buffer compositions
- Add chaperone proteins during refolding
Low yieldExpression challenges- Optimize codon usage
- Test different fusion tags
- Consider refolding from inclusion bodies

Recommended purification protocol:

  • Cell lysis and initial extraction:

    • Use gentle lysis methods (enzymatic or freeze-thaw)

    • Include protease inhibitors and reducing agents

    • Centrifuge to separate membrane and soluble fractions

  • Membrane protein extraction:

    • Solubilize membranes with 1% DDM or similar detergent

    • Maintain reducing environment with 1-5 mM DTT

    • Include 10% glycerol as stabilizing agent

  • Affinity purification:

    • Use Ni-NTA for His-tagged protein

    • Implement gradient elution to improve purity

    • Add low concentrations of detergent in all buffers

  • Activity preservation:

    • Store purified protein with 50% glycerol at -80°C

    • Avoid repeated freeze-thaw cycles

    • Consider flash-freezing in liquid nitrogen

Activity assays should be performed immediately after purification to establish baseline activity levels before storage or further characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.