Recombinant Chloranthus spicatus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Expression Systems
Recombinant psbB is typically expressed in E. coli with N-terminal His tags for purification .

ParameterValueSource
Species OriginChloranthus spicatus (Chloranthaceae)
Tag TypeN-terminal His tag (6xHis)
Purity>85–90% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized) or 4°C (working aliquots)

Comparison with Lactuca sativa psbB

FeatureChloranthus spicatus psbB Lactuca sativa psbB
Amino Acid SequenceA6MME8 (partial/full-length)Q332V1 (full-length)
TagVariable (determined during production)N-terminal His tag
ApplicationStructural/functional studiesBiochemical assays

Role in PSII Biogenesis

  • Psb28 Dependency: Psb28 is essential for CP47 synthesis and chlorophyll biosynthesis. Deletion mutants show reduced CP47 levels and disrupted chlorophyll production .

  • Interactions with Subunits:

    • PsbH: Required for Psb28 binding to CP47 .

    • PsbT/PsbL: Co-purify with CP47 during early assembly stages .

  • Chlorophyll Binding: Structural models suggest five histidines directly ligate chlorophyll magnesium ions, while others stabilize adjacent pigments .

Applications in Research

  • Protein Purification: His-tagged psbB facilitates isolation for spectroscopic and biochemical studies .

  • Structural Biology: Used in electron crystallography to map chlorophyll arrangements in PSII .

Challenges and Future Directions

  • Protease Sensitivity: Repeated freezing/thawing degrades recombinant psbB; aliquoting is critical .

  • Functional Limitations: Recombinant psbB lacks native chlorophyll binding unless co-expressed with pigments in E. coli .

  • Evolutionary Studies: Synteny analysis of Chloranthus genomes reveals conserved psbB regions, aiding phylogenetic studies of Magnoliidae .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGINNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLSENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGPMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Chloranthus spicatus CP47 protein?

The CP47 protein in C. spicatus functions as an integral antenna complex within Photosystem II. It contains approximately 16 chlorophyll molecules that form part of the core light-harvesting apparatus . Structurally, CP47 is a membrane-bound protein that interacts with other PSII components including D1, D2, cytochrome b559, and PsbI to form a functional photosynthetic complex . When working with the recombinant version, researchers should note that while the primary sequence is preserved, the protein's tertiary structure may require specific conditions to achieve native conformation, particularly regarding chlorophyll binding.

What are the primary differences between CP47 in C. spicatus and other plant species?

While the core function of CP47 is conserved across photosynthetic organisms, phylogenetic analysis based on complete chloroplast genome sequencing shows that C. spicatus CP47 is most closely related to that of C. erectus and C. japonicus . Species-specific variations in the protein sequence may affect excitation energy transfer efficiency and spectral properties. Comparative analyses should include:

SpeciesChloroplast Genome SizeCP47 Sequence IdentityNotable CP47 Structural Differences
C. spicatus158,758 bp100% (reference)Contains 16 chlorophyll molecules; specific red-shifted positions at B3, B1
C. erectusSimilar to C. spicatus>95% (estimated)Highly conserved chlorophyll binding sites
C. japonicusSimilar to C. spicatus>95% (estimated)Highly conserved chlorophyll binding sites
Model organisms (e.g., Arabidopsis)Variable~85-90% (estimated)May contain slight variations in chlorophyll positioning

What expression systems are most effective for producing functional recombinant C. spicatus CP47 protein?

  • Using specialized E. coli strains (such as C41/C43 or BL21-AI) designed for membrane protein expression

  • Expressing the protein with a fusion tag (His6, MBP, or GST) to aid solubility and purification

  • Employing a dual-plasmid system to co-express chlorophyll synthesis enzymes when attempting to produce holoproteins

  • Optimizing induction conditions (temperature reduction to 16-18°C, low IPTG concentrations)

For studies requiring the apoprotein form (without bound chlorophylls), standard BL21(DE3) strains may be sufficient .

What purification protocols are recommended for isolating CP47 with intact structural properties?

Purification of recombinant CP47 requires protocols that maintain protein stability while removing contaminants. A recommended methodological approach includes:

  • Initial extraction using mild detergents (n-dodecyl-β-D-maltoside or digitonin) to solubilize membrane proteins

  • Affinity chromatography using the protein's fusion tag

  • Size exclusion chromatography to remove aggregates and obtain monodisperse protein

  • Assessment of protein quality using circular dichroism to confirm secondary structure integrity

For reconstitution studies with chlorophylls, researchers should perform the final purification steps in dim green light to prevent photodamage to added pigments.

How can researchers accurately measure chlorophyll binding properties of recombinant CP47?

Comprehensive analysis of chlorophyll binding requires multiple complementary techniques:

  • Absorption spectroscopy (350-750 nm) to identify characteristic chlorophyll peaks and red-shifted components

  • Fluorescence excitation and emission spectroscopy to assess energy transfer between chlorophylls

  • Circular dichroism in the visible region to examine pigment-protein interactions

  • Time-resolved spectroscopy to measure excitation energy lifetimes and transfer rates

Recent quantum mechanics/molecular mechanics (QM/MM) approaches with time-dependent density functional theory have successfully mapped the distribution of site energies among the 16 chlorophyll molecules in CP47, identifying B3 followed by B1 as the most red-shifted chlorophylls . This computational approach can complement experimental measurements when studying mutant proteins or comparing CP47 from different species.

What are the most informative mutational analyses for studying CP47 structure-function relationships?

Strategic mutational analysis of the psbB gene can provide insights into CP47 function. Key approaches include:

  • Alanine scanning of conserved histidine residues involved in chlorophyll binding

  • Conservative mutations (e.g., phenylalanine to tyrosine) in aromatic residues near chlorophyll binding sites

  • Charge-altering mutations in regions believed to interact with other PSII subunits

  • Chimeric constructs swapping domains between CP47 from different species to identify species-specific functional elements

Functional assessment of these mutants should include absorption spectroscopy, fluorescence lifetime measurements, and when possible, reconstitution with other PSII components to assess energy transfer efficiency.

How does the electrostatic environment affect CP47 chlorophyll site energies?

The protein matrix creates specific electrostatic environments that tune the excited state energies of bound chlorophylls. QM/MM studies have demonstrated that the protein environment can shift chlorophyll excitation energies by up to 15-20 nm . Methodological approaches to investigate these effects include:

  • pH-dependent spectroscopy to identify titratable residues affecting chlorophyll properties

  • Site-directed mutagenesis of charged residues near chlorophyll binding sites

  • Comparative analysis of CP47 in different detergent environments or reconstituted in liposomes

  • Computational modeling using Poisson-Boltzmann equations to map electrostatic potentials

Chlorophyll PositionExcitation Wavelength (nm)Major Contributing ResiduesEnvironmental Sensitivity
B3Longest wavelengthNearby charged/polar residuesHigh
B1Second-longest wavelengthProtein matrix interactionsHigh
Other positionsShorter wavelengthsVariousVariable

How has the psbB gene evolved within the Chloranthaceae family?

The psbB gene is part of the chloroplast genome in C. spicatus, which has been fully sequenced (158,758 bp) . Evolutionary analysis should incorporate:

  • Multiple sequence alignment of psbB genes from related species

  • Calculation of synonymous vs. non-synonymous substitution rates to identify selection pressures

  • Structural mapping of conserved vs. variable regions

  • Analysis of coevolution between psbB and genes encoding interacting proteins

Phylogenetic analysis based on complete chloroplast genome sequencing confirms that C. spicatus is closely related to C. erectus and C. japonicus within the Chloranthaceae family .

How does CP47 from C. spicatus compare functionally with cyanobacterial homologs?

While cyanobacterial CP47 serves similar functions, the protein operates within different membrane environments and photosynthetic architectures. Comparable studies should examine:

  • Spectroscopic differences in chlorophyll site energies

  • Structural variations using homology modeling

  • Energy transfer kinetics through time-resolved fluorescence

  • Interactions with other PSII components

Current research indicates that cyanobacterial systems like those in Acaryochloris marina contain CP47 that participates in similar light-harvesting functions but may utilize different chlorophyll types (Chl d vs. Chl a) .

What are the optimal storage conditions for maintaining recombinant CP47 activity?

The recombinant protein requires specific storage conditions to maintain structural integrity and function:

  • Store at -20°C for regular use, or at -80°C for extended storage periods

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation

  • For working solutions, maintain aliquots at 4°C for no more than one week

  • Include glycerol (typically 10-15%) in storage buffers to prevent freeze damage

  • For studies involving chlorophyll-bound forms, store samples in the dark to prevent photodamage

What controls should be included when studying recombinant CP47 function in vitro?

Rigorous experimental design requires appropriate controls:

  • Heat-denatured protein samples to establish baseline for binding assays

  • Parallel analysis of CP47 from model organisms (e.g., Arabidopsis) for comparative studies

  • Empty expression vector preparations to identify potential contaminating proteins from the host

  • Spectroscopic standards for chlorophyll quantification and wavelength calibration

  • Time-zero measurements for any kinetic or time-resolved experiments

How can researchers overcome protein aggregation issues when working with recombinant CP47?

Membrane proteins like CP47 are prone to aggregation when removed from their native lipid environment. Effective strategies include:

  • Screening multiple detergents at various concentrations (typically LDAO, DDM, or GDN)

  • Adding lipids during purification (DOPC, POPE, or native thylakoid lipid extracts)

  • Using amphipols or nanodiscs for detergent-free stabilization

  • Optimizing buffer conditions through thermal stability assays

  • Employing glycerol or sucrose as stabilizing agents

What approaches can resolve contradictory data in CP47 site energy measurements?

Different experimental techniques may yield apparently contradictory results when measuring chlorophyll site energies in CP47. Reconciliation approaches include:

  • Systematic comparison of sample preparation methods to identify potential artifacts

  • Combined use of multiple spectroscopic techniques on identical samples

  • Correlation of experimental data with computational predictions

  • Temperature-dependent measurements to distinguish between enthalpic and entropic contributions

  • Analysis of concentration dependence to identify potential aggregation effects

How might synthetic biology approaches enhance our understanding of CP47 function?

Emerging synthetic biology tools offer new avenues for CP47 research:

  • De novo design of simplified CP47-like proteins to identify minimal functional units

  • Incorporation of non-natural amino acids at key positions to probe specific interactions

  • Construction of hybrid light-harvesting systems combining elements from different photosynthetic organisms

  • Development of CP47-based biosensors for environmental monitoring

What are the prospects for using CP47 in artificial photosynthetic systems?

The light-harvesting properties of CP47 make it potentially valuable for bioinspired energy technologies:

  • Integration into hybrid materials for solar energy capture

  • Template design for synthetic light-harvesting complexes

  • Component in biohybrid devices coupling biological light capture to artificial reaction centers

  • Model system for designing more efficient photovoltaic architectures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.