Recombinant Chloranthus spicatus Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant Chloranthus spicatus Photosystem Q(B) protein (UniProt ID: A6MMA2) is a genetically engineered variant of the native D1 protein (PsbA) from Chloranthus spicatus, a plant species in the Chloranthaceae family. This protein is a critical component of Photosystem II (PSII), a membrane-bound complex responsible for water oxidation and plastoquinone reduction during oxygenic photosynthesis . The recombinant form enables detailed biochemical and structural studies of PSII’s electron transport mechanisms, particularly at the QB-binding site, which facilitates plastoquinone (PQ) reduction .

Amino Acid Sequence and Production

  • Full-length sequence: Comprises 344 amino acids, including conserved residues critical for QB binding (e.g., D1-His215, D1-Ser264) .

  • Expression system: Produced in Escherichia coli with an N-terminal His-tag for purification .

  • Post-translational modifications: Lacks chlorophyll and xanthophylls in its recombinant form, unlike native PSII complexes .

Functional Role in Photosystem II

The QB-binding site, formed by the D1 protein, coordinates plastoquinone molecules during PSII’s electron transport chain:

  1. Electron transfer: QB accepts two electrons and two protons, forming plastoquinol (PQH2), which diffuses into the thylakoid membrane .

  2. Redox tuning: The QB site’s midpoint potential is influenced by H-bonding interactions with D1-His215 and D1-Ser264, ensuring efficient charge separation .

  3. Photoactivation: The recombinant protein retains the ability to bind PQ analogs, making it valuable for studying PSII assembly and repair .

Research Applications

  • ELISA and antibody production: Used as an antigen to generate antibodies for PSII quantification in plant physiology studies .

  • In vitro reconstitution: Combined with chlorophylls and xanthophylls to study pigment-protein interactions .

  • Mutational analysis: Site-directed mutants (e.g., D1-His215→Ala) clarify QB’s role in photodamage and repair mechanisms .

Table 2: Evolutionary and Functional Comparison

SpeciesC. spicatus (A6MMA2)Calycanthus floridus (Q7YJY8)Prorocentrum micans (Q9TM72)
Sequence Identity100% (native)92%78%
QB-Binding ResiduesConservedConservedPartially divergent
Reconstitution EfficiencyHigh (in vitro)ModerateLow
ApplicationsPSII repair studiesEvolutionary analysisDinoflagellate PSII research

Data derived from recombinant protein databases .

Key Research Findings

  1. Xanthophyll selectivity: Recombinant D1 exhibits preferential binding to violaxanthin over neoxanthin in vitro, mimicking native PSII behavior .

  2. Thermostability: The protein remains stable at 4°C for up to one week, facilitating prolonged experimental workflows .

  3. Role in photoprotection: Mutations in the QB site alter charge recombination pathways, impacting PSII’s resilience to high-light stress .

Challenges and Future Directions

  • Limitations: Lack of native cofactors (e.g., chlorophyll a) restricts functional studies of electron transport .

  • Emerging applications: Integration into artificial photosynthetic systems for renewable energy research .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Chloranthus spicatus (Chulantree) (Nigrina spicata)
Target Names
psbA
Target Protein Sequence
MTAILERRETTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its role in photosynthesis?

The Photosystem Q(B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, plays a critical role in photosynthetic electron transport. It functions as part of the photosystem II complex where it serves as the binding site for the terminal electron acceptor plastoquinone molecule QB. The protein is essential for the photo-induced charge separation that drives photosynthetic oxygen evolution. During photosynthesis, electronic excitation of chlorophyll leads to electron transfer via pheophytin in the D1 protein to two plastoquinone molecules, QA and QB. The QB molecule accepts two electrons via the primary quinone QA and two protons, forming part of the electron transport chain that powers photosynthesis .

How does the Chloranthus spicatus Photosystem Q(B) protein compare to homologous proteins from other species?

Comparative analysis between Chloranthus spicatus and Synechocystis sp. Photosystem Q(B) proteins reveals both conservation and divergence in their sequences:

FeatureChloranthus spicatusSynechocystis sp.
UniProt IDA6MMA2P07826
Common namePhotosystem II D1 proteinPhotosystem Q(B) protein 1
Sequence length344 amino acids344 amino acids
Gene namepsbApsbA1
Sequence similarityReferenceHigh conservation in functional domains
Species typeHigher plantCyanobacterium
Notable differencesPlant-specific sequence adaptationsContains TTQL motif at N-terminus instead of TAIL

While both proteins share the same fundamental function in electron transport, the sequence variations reflect evolutionary adaptations to different photosynthetic environments. The core functional domains responsible for quinone binding and electron transfer remain highly conserved across species, while peripheral regions show greater divergence. These differences may contribute to species-specific optimization of photosynthesis under varying environmental conditions .

What are the optimal storage and handling conditions for recombinant Chloranthus spicatus Photosystem Q(B) protein?

For optimal maintenance of protein integrity and activity, the following storage and handling protocols are recommended:

  • Long-term storage: Store the protein at -20°C for routine storage, or at -80°C for extended preservation of activity

  • Storage buffer: The protein should be maintained in a Tris-based buffer containing 50% glycerol optimized for protein stability

  • Aliquoting: Divide the stock solution into single-use aliquots to avoid repeated freeze-thaw cycles

  • Working storage: Working aliquots can be stored at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and activity loss

Research has demonstrated that maintaining strict storage protocols significantly improves the reproducibility of experimental outcomes when working with photosystem proteins. The high glycerol concentration (50%) in the storage buffer is particularly important as it prevents ice crystal formation during freezing, which would otherwise damage the protein's structural integrity .

How can researchers effectively reconstitute recombinant photosystem proteins in vitro?

In vitro reconstitution of photosystem proteins requires careful methodology to ensure proper folding and function. Based on successful approaches with similar proteins, the following protocol is recommended:

  • Expression of apoprotein: Express the protein-coding gene (e.g., psbA gene for Photosystem Q(B) protein) in a bacterial expression system

  • Purification: Isolate the expressed apoprotein using affinity chromatography

  • Preparation of pigments: Obtain purified chlorophylls (a and b) and xanthophylls (including lutein and violaxanthin)

  • Reconstitution mixture: Combine the apoprotein with pigments in an appropriate detergent buffer system

  • Folding conditions: Subject the mixture to controlled folding conditions (temperature, pH, ionic strength)

  • Purification of holoprotein: Remove unbound pigments and improperly folded proteins

  • Verification: Confirm successful reconstitution through spectroscopic analysis and functional assays

This approach has been successfully employed with related photosystem proteins like CP24, yielding recombinant proteins with properties essentially identical to native proteins extracted from plant thylakoids. Spectroscopic analysis, including absorbance spectra and Gaussian deconvolution, can be used to verify the correct binding of chlorophylls and xanthophylls within the reconstituted protein .

What spectroscopic methods are most effective for characterizing chromophore organization in recombinant Photosystem Q(B) protein?

Comprehensive characterization of chromophore organization in recombinant Photosystem Q(B) protein requires multiple complementary spectroscopic approaches:

  • Absorption spectroscopy: Measures the wavelength-dependent light absorption profile of bound chlorophylls and carotenoids

  • Circular dichroism (CD): Assesses the organization and excitonic coupling between pigments

  • Fluorescence spectroscopy: Provides information on energy transfer pathways and efficiency

  • Gaussian deconvolution analysis: Resolves overlapping spectral features to identify individual chromophore contributions

  • Time-resolved spectroscopy: Measures energy transfer and electron transport kinetics

  • Resonance Raman spectroscopy: Characterizes specific vibrational modes of bound pigments

For chlorophyll binding analysis, spectroscopic studies of related proteins have identified specific absorption bands. For example, in CP24, Gaussian deconvolution has identified four chlorophyll b absorption subbands (at 638, 645, 653, and 659 nm) and four chlorophyll a bands (at 666, 673, 679, and 686 nm). Similar approaches can be applied to Photosystem Q(B) protein to map its chromophore organization .

How can site-directed mutagenesis be applied to study structure-function relationships in Photosystem Q(B) protein?

Site-directed mutagenesis offers powerful insights into structure-function relationships of the Photosystem Q(B) protein. A systematic approach includes:

  • Target identification: Select residues for mutation based on:

    • Sequence conservation across species

    • Predicted involvement in chromophore binding

    • Proximity to electron transport pathways

    • Participation in protein-protein interactions

  • Mutation design strategies:

    • Conservative substitutions to probe specific interactions

    • Non-conservative substitutions to disrupt function

    • Alanine scanning to identify essential residues

    • Introduction of spectroscopic probes via unnatural amino acids

  • Functional assessment methods:

    • Electron transport measurements

    • Fluorescence lifetime analysis

    • Binding affinity determinations for quinones

    • Thermodynamic stability analysis

  • Data analysis framework:

    • Correlation of structural perturbations with functional outcomes

    • Integration with computational modeling

    • Comparison with evolutionary conservation patterns

This approach has successfully identified key residues involved in chlorophyll binding and protein folding in related photosystem proteins. For example, studies on light-harvesting complex proteins have revealed that certain chlorophyll binding sites are selective for chlorophyll a and essential for protein folding, while others can accommodate either chlorophyll a or b .

What role does the Photosystem Q(B) protein play in photoprotection mechanisms, and how can it be experimentally investigated?

The Photosystem Q(B) protein plays a critical role in photoprotection mechanisms that prevent photodamage under high light conditions. Key aspects include:

  • Photoprotection mechanisms involving Q(B) protein:

    • Regulation of electron flow through the QB site

    • Involvement in proton-mediated photoprotection

    • Interaction with bicarbonate at the non-heme iron complex

    • Stabilization of semiquinone intermediates (QA- −/QAH- )

  • Experimental approaches for investigation:

    • Time-resolved electron paramagnetic resonance (EPR) to detect radical intermediates

    • Measurement of QA redox potential under varying conditions

    • pH-dependent activity assays to assess proton effects

    • Site-directed mutagenesis of residues near the bicarbonate binding site

    • Reconstitution experiments with altered bicarbonate concentrations

  • Biophysical parameters to monitor:

    • Forward and backward electron transfer rates

    • Formation and decay kinetics of the QA- − radical

    • Protonation states of key residues

    • Structural changes under high light conditions

Research suggests that bicarbonate protonation and decomposition may form the basis of a photoprotection mechanism via QA- −/QAH- stabilization. This mechanism helps regulate electron transport under excess light conditions, preventing the formation of reactive oxygen species and subsequent photodamage to the photosynthetic apparatus .

How can researchers optimize expression systems for high-yield production of functional recombinant Photosystem Q(B) protein?

Optimizing expression systems for membrane proteins like Photosystem Q(B) requires addressing several technical challenges:

  • Expression system selection:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliFast growth, high yields, low costLacks chloroplast-specific chaperonesCodon optimization, low temperature induction (16-18°C)
Insect cellsBetter folding of complex proteinsHigher cost, longer production timeOptimization of MOI, harvest timing
Chloroplast-containing organismsNative folding environmentLower yields, complex purificationSelection of appropriate species, growth condition optimization
  • Gene design considerations:

    • Codon optimization for the selected expression system

    • Inclusion of appropriate purification tags (His, Strep, or FLAG)

    • Modification of hydrophobic regions to improve folding

    • Potential fusion with solubility-enhancing partners

  • Protein extraction and purification:

    • Detergent screening for optimal solubilization (e.g., β-DDM, LMNG)

    • Two-step purification strategy (affinity chromatography followed by size exclusion)

    • Buffer optimization to maintain protein stability

    • Addition of lipids during purification to stabilize the protein

  • Functional validation methodologies:

    • Spectroscopic analysis of pigment binding

    • Electron transport activity assays

    • Thermal stability assessments

    • Verification of correct folding through circular dichroism

Researchers have successfully used similar strategies for related photosystem proteins, achieving yields and purity suitable for both functional studies and structural analyses .

How do the pigment-binding properties of Photosystem Q(B) protein compare to other light-harvesting complexes?

Photosystem Q(B) protein exhibits distinct pigment-binding properties compared to other light-harvesting complexes in the photosynthetic apparatus:

Protein ComplexChlorophyll ContentXanthophyll ContentBinding SelectivityFunctional Role
Photosystem Q(B) (D1)Primary focus on electron transport, less emphasis on light harvestingLimited carotenoid bindingHighly selective binding sitesPrimary electron acceptor in PSII
CP269 chlorophylls per monomer2 xanthophylls per monomerThree sites selective for Chl aLight harvesting, energy transfer
CP2410 chlorophylls (a+b) per monomer2 xanthophylls per monomerHigh selectivity for violaxanthinRegulation of excited states
LHCII (major)14 chlorophylls per monomer4 xanthophylls per monomerMixed selectivity sitesPrimary light harvesting

The differences in pigment binding reflect the specialized functions of each protein. While light-harvesting complexes like CP26 and CP24 are optimized for efficient light absorption and energy transfer with multiple chlorophyll binding sites, the Photosystem Q(B) protein is primarily involved in electron transport reactions. The CP26 complex has been found to contain three chlorophyll binding sites that are selective for chlorophyll a, with one being essential for protein folding. Similarly, CP24 exhibits selectivity in xanthophyll binding, coordinating specifically with violaxanthin and lutein rather than neoxanthin or beta-carotene .

What are the current challenges in studying the electron transfer mechanisms in recombinant Photosystem Q(B) protein?

Researchers face several significant challenges when investigating electron transfer mechanisms in recombinant Photosystem Q(B) protein:

  • Structural integrity preservation:

    • Maintaining the delicate non-heme iron environment during recombinant expression

    • Preserving native quinone binding pocket geometry

    • Ensuring proper incorporation of all cofactors

  • Temporal resolution limitations:

    • Electron transfer occurs at picosecond to microsecond timescales

    • Current spectroscopic techniques may have insufficient resolution

    • Challenges in synchronizing reaction initiation across a sample

  • Environmental factors affecting measurements:

    • Influence of detergents used for protein solubilization

    • Impact of artificial lipid environments versus native thylakoid membrane

    • Temperature and pH dependence of electron transfer rates

  • Technical measurement challenges:

    • Distinguishing between multiple electron transfer pathways

    • Accurately measuring redox potentials of intermediates

    • Correlating structural changes with electron transfer events

  • Methodological approaches to address challenges:

    • Development of membrane mimetic systems (nanodiscs, liposomes)

    • Application of ultrafast spectroscopy with improved temporal resolution

    • Integration of computational modeling with experimental data

    • Design of site-specific probes for electron transfer intermediates

Understanding these electron transfer mechanisms is critical because they form the foundation of photosynthetic efficiency and are potential targets for optimization in applied photosynthesis research .

How might genetic engineering of the Photosystem Q(B) protein improve photosynthetic efficiency for biofuel applications?

Strategic genetic engineering of the Photosystem Q(B) protein offers several promising approaches for enhancing photosynthetic efficiency in biofuel applications:

This approach aligns with research showing that while native photosynthetic proteins are effective at supporting organism survival, they are remarkably inefficient at the large-scale energy conversion required for biofuel production. Through targeted mutagenesis complemented by advanced spectroscopy and computational modeling, researchers aim to bridge this efficiency gap and develop optimized photosystems for sustainable bioenergy applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.