Recombinant Chlorella protothecoides Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Introduction to Cytochrome b6 and Its Significance

Cytochrome b6 represents a critical component of the cytochrome b6f complex, which serves as an essential intermediate in the photosynthetic electron transport chain of photosynthetic organisms, including algal species like Chlorella protothecoides. This integral membrane protein functions primarily as an electron carrier, facilitating the transfer of electrons between photosystems II and I during photosynthesis .

Understanding the structure, function, and recombinant production of this protein from Chlorella protothecoides could provide valuable insights for biotechnological applications, particularly in the fields of bioenergy and sustainable biomanufacturing.

Taxonomic Classification and Relationship

An important consideration when studying Chlorella protothecoides cytochrome b6 is the recent taxonomic reclassification of this organism. Historically identified as Chlorella protothecoides, this green microalga has been reclassified as Auxenochlorella protothecoides based on molecular phylogenetic analyses, though both names appear in scientific literature depending on publication date .

Phylogenetic analysis based on chloroplast genome sequencing reveals that Prototheca cutis is the closest known relative to Auxenochlorella protothecoides, followed by various members of the genus Chlorella . This close evolutionary relationship is reflected in the significant similarities observed in genome structure and organization, particularly in genes associated with photosynthetic processes.

The chloroplast DNA (cpDNA) of Auxenochlorella protothecoides encodes 37 genes that show high homology to representative cyanobacteria species, suggesting an evolutionary connection that provides insights into the origin and conservation of photosynthetic proteins like cytochrome b6 .

Molecular Structure and Organization

Cytochrome b6 is a membrane-spanning protein that constitutes one of the four major subunits of the cytochrome b6f complex, alongside cytochrome f (PetA), the Rieske-FeS protein (PetC), and PetD . Based on data from related species, the full-length protein typically consists of approximately 215-222 amino acids and contains multiple transmembrane domains that anchor it within the thylakoid membrane.

While the exact sequence of Chlorella protothecoides cytochrome b6 is not directly provided in the available research, we can gain insights from the amino acid sequences of related species. For instance, in Prochlorothrix hollandica, the full-length cytochrome b6 protein (PetB) consists of 222 amino acids , while in Nostoc sp., it comprises 215 amino acids . The high degree of conservation in this protein suggests that the Chlorella protothecoides version would share significant homology with these sequences.

The Cytochrome b6f Complex

The cytochrome b6f complex functions as a dimeric structure within the thylakoid membrane, serving as an electronic connection between photosystems II and I. This complex consists of four large subunits and four small subunits , with cytochrome b6 (PetB) being one of the large, core subunits.

The complex binds several essential cofactors that facilitate electron transport, including:

  • The heme c of cytochrome f

  • The newly discovered heme ci0 covalently attached to cytochrome b6 in the quinone binding site Qi

  • Additional heme groups and iron-sulfur clusters

These cofactors play crucial roles in the electron transport function of the complex, enabling it to catalyze the transfer of electrons from plastoquinol to plastocyanin in the electron transport chain.

Role in Photosynthetic Electron Transport

Cytochrome b6 plays a pivotal role in photosynthetic electron transport by participating in the "Q cycle," a mechanism that couples electron transfer to proton translocation across the thylakoid membrane. This process contributes to the generation of a proton gradient that drives ATP synthesis.

Comparative transcriptomic analyses in related algal species have revealed significant changes in the expression levels of cytochrome b6f complex components during transitions between heterotrophic and photoautotrophic growth conditions . For example, the expression levels of PetC (cytochrome b6-f complex iron-sulfur subunit) and PetN (cytochrome b6-f complex subunit 8) undergo notable changes during these metabolic shifts, as shown in the following table adapted from research findings:

GeneProtein DescriptionExpression Change During Heterotrophy-to-Photoautotrophy Transition
PetCCytochrome b6-f complex iron-sulfur subunit-0.89 to -2.11
PetNCytochrome b6-f complex subunit 8+1.31 to -1.66
PetEPlastocyanin-5.35 to -6.73
PetFFerredoxin-1.23 to -3.47

These expression changes highlight the dynamic regulation of the cytochrome b6f complex in response to environmental conditions, with implications for understanding photosynthetic efficiency in Chlorella protothecoides.

Chloroplast Genome Organization

The chloroplast genome of Auxenochlorella protothecoides (formerly Chlorella protothecoides) UTEX 25 has been completely sequenced, revealing a genome size of 84,576 base pairs with a 30.8% GC content . This compact genome encodes 78 predicted open reading frames, 32 tRNAs, and 4 rRNAs, making it notably smaller than the chloroplast genomes of related species such as Chlorella variabilis (124,579 bp) and Chlorella vulgaris (150,613 bp) .

The petB gene, which encodes cytochrome b6, is presumed to be among these chloroplast-encoded genes, consistent with its location in other photosynthetic organisms. The compact nature of the Auxenochlorella protothecoides chloroplast genome is primarily attributable to reduced intergenic sequence content rather than a loss of coding capacity .

Comparative Genomics

Comparative genomic analysis reveals that the coding regions of the chloroplast genome in Auxenochlorella and Chlorella species are organized in conserved colinear blocks, with some rearrangements . This conservation suggests that the petB gene structure and organization in Chlorella protothecoides would be similar to that in related species.

The genome structure and composition similarities between Auxenochlorella and Chlorella species are particularly evident in genes influencing photosynthetic efficiency, including those encoding components of the photosynthetic apparatus such as the cytochrome b6f complex . This conservation underscores the fundamental importance of these genes in photosynthetic function across diverse algal lineages.

Expression Systems for Recombinant Production

Based on protocols established for related proteins, recombinant production of Chlorella protothecoides cytochrome b6 would likely involve heterologous expression in a suitable host organism, with Escherichia coli being the most common choice. The available research indicates that recombinant cytochrome b6 proteins from other species have been successfully expressed in E. coli with N-terminal histidine tags to facilitate purification .

The expression system typically involves:

  1. Cloning the petB gene into an appropriate expression vector

  2. Transformation of the construct into E. coli host cells

  3. Induction of protein expression under controlled conditions

  4. Cell lysis and extraction of the recombinant protein

  5. Purification using affinity chromatography

While the expression of membrane proteins like cytochrome b6 presents challenges due to their hydrophobic nature and complex folding requirements, established protocols for related proteins suggest that these challenges can be overcome through careful optimization of expression conditions.

The functional properties of recombinant Chlorella protothecoides cytochrome b6 would be closely tied to its role in electron transport. Functional assays for the recombinant protein could include measurements of electron transfer activity, binding to other components of the cytochrome b6f complex, and reconstitution studies in artificial membrane systems.

Potential applications of the recombinant protein include:

  1. Structural and functional studies of the cytochrome b6f complex

  2. Development of in vitro assays for electron transport

  3. Investigation of protein-protein interactions within the photosynthetic apparatus

  4. Screening of compounds that modulate electron transport activity

  5. Generation of antibodies for immunological studies

These applications could contribute to a better understanding of photosynthetic electron transport in Chlorella protothecoides and potentially lead to strategies for enhancing photosynthetic efficiency for biotechnological applications.

Significance for Photosynthesis Research

Research on recombinant Chlorella protothecoides cytochrome b6 contributes to our fundamental understanding of photosynthetic electron transport in algae. The protein's central role in the cytochrome b6f complex makes it a key target for studies aimed at elucidating the molecular mechanisms underlying photosynthesis.

Recent research has identified protein factors involved in the assembly and stabilization of the cytochrome b6f complex, such as the thylakoid membrane protein NTA1, which plays an essential role in the assembly of the complex . Understanding these assembly processes is crucial for comprehending how the complex functions in photosynthetic organisms like Chlorella protothecoides.

Biotechnological Applications

Chlorella protothecoides (now Auxenochlorella protothecoides) has attracted significant interest for biotechnological applications, particularly for biofuel production due to its ability to accumulate high levels of lipids under certain growth conditions . The metabolic flexibility of this organism, capable of both heterotrophic and photoautotrophic growth, makes it an attractive candidate for various biotechnological processes.

Understanding and potentially modifying the cytochrome b6f complex through studies of recombinant cytochrome b6 could lead to enhanced photosynthetic efficiency, which in turn could improve biomass production and biofuel yields. The ability to manipulate electron transport processes could potentially redirect metabolic fluxes toward desired products, such as lipids for biofuel production or high-value compounds for pharmaceutical applications.

Future Research Directions and Challenges

Several challenges and opportunities exist for future research on recombinant Chlorella protothecoides cytochrome b6:

  1. Complete characterization of the gene and protein sequence specific to Chlorella protothecoides

  2. Development of optimized expression systems for the efficient production of functional recombinant protein

  3. Structural studies using advanced techniques such as cryo-electron microscopy to elucidate the three-dimensional structure of the protein within the cytochrome b6f complex

  4. Investigation of the role of post-translational modifications in protein function

  5. Engineering of the protein to enhance photosynthetic efficiency or introduce novel functionalities

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and biotechnology. The insights gained from such studies could have significant implications for both fundamental photosynthesis research and applied biotechnology using Chlorella protothecoides as a platform organism.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during the production process. Should you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Auxenochlorella protothecoides (Green microalga) (Chlorella protothecoides)
Target Names
petB
Target Protein Sequence
MSKIYDWFEERLEIQSIADDISSKYVPPHVNIFYCFGGITFTCFLVQVATGFAMTFYYRP TVAEAFTSVQYLMTQVNFGWLIRSIHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVT GVLMAVCTVSFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGQVLLELLRGGVAVGQSTL TRFYSLHTFVLPLFTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a crucial component of the cytochrome b6-f complex. This complex plays a vital role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also contributes to cyclic electron flow around PSI and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of Cytochrome b6 (petB) in photosynthetic organisms like Chlorella protothecoides?

Cytochrome b6, encoded by the petB gene, is one of the four large subunits of the cytochrome b6f complex (Cyt b6f) that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis. This complex is crucial for catalyzing quinol oxidation and plastocyanin reduction, thereby establishing the proton force required for ATP synthesis . In the cytochrome b6f complex, cytochrome b6 organizes the electron transfer chain alongside other large subunits like cytochrome f (petA), subunit IV (petD), and the Rieske/Iron/sulfur protein (petC) . The complex contains multiple transmembrane helices, with cytochrome b6 contributing helices A-D to the core architecture .

What expression systems yield optimal results for recombinant Cytochrome b6 production?

Recombinant Cytochrome b6 can be expressed and purified from different host systems, with E. coli and yeast offering the best yields and shorter turnaround times . For studies requiring post-translational modifications necessary for proper protein folding or activity, expression in insect cells with baculovirus or mammalian cells is recommended . When expressing recombinant cytochrome b6, researchers typically fuse it with tags (commonly His-tags) to facilitate purification . The expression vector design should consider codon optimization for the chosen host system and include appropriate promoters for efficient transcription.

Methodologically, researchers should:

  • Design constructs with appropriate fusion tags (N-terminal His tags are commonly used)

  • Transform into expression hosts (E. coli BL21 or similar strains for prokaryotic expression)

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider co-expression with chaperones if folding issues arise

  • Incorporate heme precursors in growth media if necessary for proper cofactor integration

How does Cytochrome b6 contribute to the regulation of electron transport pathways in photosynthesis?

Cytochrome b6 functions within the cytochrome b6f complex to mediate both linear electron transfer (LET) and cyclic electron transfer (CET). In LET, electrons flow from photosystem II through the cytochrome b6f complex to photosystem I, generating NADPH and a proton gradient for ATP synthesis. In CET, electrons cycle back from photosystem I to the cytochrome b6f complex, generating only the proton gradient without producing NADPH .

Recent cryo-EM structural studies have revealed that heme cn in cytochrome b6 may serve as the conduit for electrons in CET. The distance between heme cn and regulatory proteins like PetP (approximately 15.9 Å as measured from the nearest edge of PetP to the edge of heme cn Fe) suggests a functional relationship in regulating electron flow pathways . Researchers investigating these mechanisms should consider:

  • Measuring electron transport rates using oxygen evolution activity assays

  • Using specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone to analyze cytochrome b6f-dependent processes

  • Employing spectroscopic methods to track electron flow through different cofactors

  • Analyzing state transitions through 77K fluorescence spectra and room temperature fluorescence kinetics

What methodologies are effective for studying functional interactions between Cytochrome b6 and regulatory proteins?

To study interactions between cytochrome b6 and regulatory proteins (such as PetP in cyanobacteria), researchers can employ multiple complementary approaches:

  • In situ reconstitution: Purify the individual components (cytochrome b6f complex and regulatory proteins) and reconstitute the complex in vitro. For example, researchers have successfully used His-tagged PetP bound to Ni²⁺ resin to capture and co-elute cytochrome b6f complex, demonstrating interaction .

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify interaction sites. This approach has been used to validate the binding position of PetP to cytochrome b6f .

  • Cryo-EM structural analysis: High-resolution structures can reveal interaction interfaces. Comparative analysis of structures with and without regulatory proteins can identify conformational changes and binding sites .

  • Mutational analysis: Strategic mutations at potential interaction sites can disrupt binding and affect function. For example, mutations targeting the interface between PetP and cytochrome b6 (such as Arg125 in subunit IV, which forms hydrogen bonds with Asp16 and Asp39 of PetP) could disrupt their interaction .

How can engineered mutations in Cytochrome b6 illuminate its functional mechanisms?

Strategic mutations in cytochrome b6 can provide valuable insights into its function. The PETC-P171L mutation in Chlamydomonas reinhardtii offers an instructive example of this approach. This mutation, which affects the Rieske protein component of the cytochrome b6f complex, revealed conditional phenotypes dependent on oxygen availability .

When designing mutation studies:

  • Target conserved residues identified through sequence alignments

  • Focus on regions near cofactor binding sites or protein-protein interaction interfaces

  • Consider conditional mutations that manifest under specific stress conditions

  • Use site-directed mutagenesis techniques for precise genetic modifications

  • Create complementation constructs to validate mutant phenotypes

After generating mutants, comprehensive phenotypic characterization should include:

  • Growth rate analysis under various conditions

  • Photosynthetic electron transfer measurements

  • Protein accumulation and complex stability analysis

  • Spectroscopic characterization of cofactor binding and function

What spectroscopic techniques are most informative for analyzing recombinant Cytochrome b6 functional properties?

Several spectroscopic techniques provide valuable information about cytochrome b6 structure and function:

  • UV/Vis absorption spectroscopy: Essential for confirming proper heme incorporation and oxidation state. Cytochrome b6f shows characteristic absorption peaks when reduced with sodium ascorbate (solid line) and sodium dithionite (dotted line), with distinctive contributions from hemes b (564 nm) and f (558 nm) .

  • 77K fluorescence spectroscopy: Valuable for examining state transitions and energy distribution between photosystems. This technique has been used to show that mutations affecting cytochrome b6f function can abolish state transitions .

  • Room temperature fluorescence kinetics: Provides information about electron flow dynamics and can be conducted in the presence of electron carriers like TMPD (N,N,N',N'-tetramethyl-p-phenylenediamine) to bypass cytochrome b6f and identify specific defects .

  • Electron paramagnetic resonance (EPR): Useful for studying the electronic structure of heme cofactors and iron-sulfur clusters within the cytochrome b6f complex.

What approaches are effective for analyzing the impact of Cytochrome b6 modifications on photosynthetic parameters?

To assess how modifications to cytochrome b6 affect photosynthetic performance, researchers should employ multiple complementary techniques:

  • Chlorophyll fluorescence measurements: Maximum quantum yield of PS II (Fv/Fm) and light response curves of electron transport rate (ETR) can detect subtle changes in photosynthetic efficiency. These parameters have been used to show that some genetic modifications do not cause stress effects in cells, as evidenced by similar Fv/Fm values between modified and wild-type strains .

  • Oxygen evolution assays: Direct measurement of photosynthetic output. In petN mutants affecting cytochrome b6f stability, oxygen evolution activity was reduced to ~30% of wild-type levels, but could be restored by adding TMPD as an alternative electron carrier .

  • State transition analysis: Important for understanding regulatory mechanisms. Techniques like 77K fluorescence spectra and room temperature fluorescence kinetics have shown that disruptions to cytochrome b6f can abolish state transitions .

  • Plastoquinone pool redox state measurement: Provides insights into electron transport chain function. In some cytochrome b6f mutants, the plastoquinone pool becomes largely reduced under normal light conditions, indicating electron transport blockage .

How does Cytochrome b6 structure and function differ between Chlorella protothecoides and other photosynthetic organisms?

Cytochrome b6 sequence comparison reveals both conservation and variation across photosynthetic organisms:

OrganismUniProt IDLengthKey Sequence FeaturesReference
Chlorella protothecoidesP13347215 aaMSKIYDWFEERLEIQSIADDISSKYVPPH (N-terminal)
Populus albaQ14FC7215 aaMSKVYDWFEERLEIQTIADDITSKYVPPH (N-terminal)
Nostoc sp.P0A384215 aaMANVYDWFEERLEIQAIAEDVTSKYVPPH (N-terminal)

The core structure and function of cytochrome b6 are conserved across species, but subtle variations exist, particularly in the N-terminal regions. These differences may reflect adaptations to specific environmental conditions or optimization for different electron transport requirements. The conserved regions typically include transmembrane domains and cofactor binding sites essential for electron transport function .

What insights can be gained from studying the loss of Cytochrome b6 in non-photosynthetic Chlorellaceae?

The study of non-photosynthetic relatives of Chlorella provides valuable insights into the evolution of photosynthetic machinery and the consequences of photosynthesis loss. Non-photosynthetic lineages like Prototheca and Helicosporidium have convergently lost a similar set of photosynthesis-related genes, including those encoding cytochrome b6f components .

Comparative genomic analyses have shown that:

  • Multiple independent losses of photosynthesis have occurred within the Chlorellaceae family .

  • The plastid genomes of non-photosynthetic Prototheca species are significantly reduced (48.2-55.6 kb) compared to photosynthetic relatives like Auxenochlorella protothecoides (84.6 kb) .

  • A specific set of 36 genes related to photosynthesis, including petB (cytochrome b6), has been lost across multiple independent non-photosynthetic lineages .

This convergent gene loss suggests strong selective pressure against maintaining photosynthetic machinery when it becomes non-essential. Interestingly, some non-photosynthetic Prototheca species (P. wickerhamii and P. cutis) retain ATP synthase genes in the plastid genome, which remain transcriptionally active despite the loss of other photosynthetic genes .

What strategies can overcome common challenges in recombinant Cytochrome b6 expression and purification?

Researchers may encounter several challenges when working with recombinant cytochrome b6:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and expression conditions

    • Consider fusion partners that enhance solubility

    • Use specialized E. coli strains designed for membrane protein expression

  • Improper heme incorporation:

    • Supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis

    • Consider expression under microaerobic conditions to facilitate heme incorporation

    • Test expression in hosts with robust heme biosynthetic pathways

  • Protein instability:

    • Use detergents like GDN (glyco-diosgenin) for membrane protein solubilization, which has been successful for cytochrome b6f complex purification

    • Include glycerol (10-50%) in storage buffers to enhance stability

    • Consider adding reducing agents to prevent oxidative damage to cofactors

How can researchers validate the functional integrity of purified recombinant Cytochrome b6?

Multiple complementary approaches should be employed to confirm the structural and functional integrity of purified recombinant cytochrome b6:

  • SDS-PAGE and Western blotting: Confirms protein size and identity. Use specific antibodies like those targeting the N-terminal region of cytochrome b6 .

  • Blue native PAGE (BN-PAGE): Assesses the oligomeric state and complex formation capacity of the purified protein .

  • UV-Vis spectroscopy: Verifies proper heme incorporation. Characteristic absorption peaks should be observed after reduction with sodium ascorbate (primarily for heme f at 558 nm) and sodium dithionite (additional features from heme b at 564 nm) .

  • Functional reconstitution: Demonstrates activity in a physiologically relevant context. For example, reconstituting purified components into liposomes or nanodiscs and measuring electron transfer activities.

  • Thermal stability assays: Provides information about protein folding and stability. Techniques like differential scanning fluorimetry can assess the impact of buffer conditions on protein stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.