Recombinant Chlorella vulgaris Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.

Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-315
Protein Length
full length protein
Species
Chlorella vulgaris (Green alga)
Target Names
petA
Target Protein Sequence
YPIFAQQNYANPREANGRIVCANCHLAEKPIEIEVPQAVLPDTVFEAVVKIPYDKQIKQV LANGKKGDLNVGAVLILPDGFEIAPPDRIPEEMKAKVGKLYFQPYSAEKKTIFVVGPVPG KKYSEMVFPILSPDPAKTKSISYLKYPIYVGGNRGRGQVYPDGSKSNNTIFTASAAGKIT AIEPAGKKGGYTLTIETANGESISEKLPPGPELVVNIGDIVGVDQALTTNPNVGGFGQGE TEVVLQNPLRIQGLLVFFLFVLLAQVFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Recombinant Chlorella vulgaris Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), supports cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How is the petA gene organized in the Chlorella vulgaris chloroplast genome?

The petA gene exists among 31 genes identified as encoding subunits of complexes involved in the light phase of photosynthesis (PSI, PSII, cytochrome b6f, and ATP synthase). Unlike some other chloroplast genes in C. vulgaris such as psbA, rpoC2, and rrnL which contain introns, the petA gene does not contain introns in this species.

Other notable features of the chloroplast genome organization include:

  • Six genes encoding rRNA

  • 18 genes encoding ribosomal proteins

  • 46 genes encoding tRNA

  • Seven genes that are components of RNA polymerase

The petA gene's structure and organization are important considerations for researchers designing expression systems for recombinant production of the protein .

What expression systems are commonly used for producing recombinant Chlorella vulgaris Apocytochrome f?

Several expression systems have been developed for the recombinant production of Chlorella vulgaris Apocytochrome f, with Escherichia coli being the most widely utilized for research purposes. When expressing this protein, researchers should consider the following methodological approaches:

E. coli expression system:

  • The recombinant protein can be produced with an N-terminal His-tag for purification purposes

  • The coding sequence (residues 31-315) of Chlorella vulgaris Apocytochrome f is optimized for E. coli codon usage

  • Expression is typically induced in E. coli under controlled conditions to maximize yield

  • The expressed protein is commonly purified using nickel affinity chromatography

Chloroplast transformation systems:
For more authentic expression, chloroplast transformation vectors like pCMCC have been developed for Chlorella vulgaris that allow:

  • Homologous recombination into the chloroplast genome

  • Use of chloroplast-specific promoters (such as Prrn from C. reinhardtii)

  • Inclusion of appropriate 5' and 3' UTR elements to enhance translation

  • Selection using antibiotic resistance markers like Aph6 (conferring kanamycin resistance)

The transformation of C. vulgaris chloroplasts can be accomplished by electroporation using:

  • Sorbitol-mannitol buffer

  • Sorbitol buffer alone

  • Specific electroporation parameters optimized for chloroplast transformation

After transformation, successful transformants can be selected on medium containing kanamycin (50 mg/L) and verified by PCR and protein expression analysis .

What are the recommended storage and handling conditions for recombinant Chlorella vulgaris Apocytochrome f?

For optimal stability and activity of recombinant Chlorella vulgaris Apocytochrome f, the following storage and handling protocols are recommended:

Storage conditions:

  • Long-term storage: -20°C to -80°C

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can lead to protein degradation

Buffer composition:

  • Tris-based buffer, pH 8.0

  • 6% Trehalose or 50% glycerol as cryoprotectants

  • Specific buffer components may be optimized depending on downstream applications

Reconstitution method:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for aliquoting and long-term storage

  • Prepare small aliquots to minimize freeze-thaw cycles

Quality control:

  • Protein purity should be greater than 90% as determined by SDS-PAGE

  • Functional activity should be verified using appropriate assays

  • Protein concentration should be determined using standardized methods

These handling protocols are essential for maintaining protein integrity and ensuring reproducible experimental results .

What molecular mechanisms regulate petA gene expression in Chlorella vulgaris and other microalgae?

The expression of the petA gene in Chlorella vulgaris and other microalgae involves complex regulatory mechanisms at both transcriptional and translational levels. Research has revealed several key factors:

Translational regulation:
Studies in Chlamydomonas reinhardtii, a related green alga, have identified a nuclear-encoded translational activator called TCA1 (Translation of Cytochrome b6f complex petA mRNA) that specifically regulates the translation of petA mRNA. This regulation occurs through interaction with the 5' untranslated region (5'UTR) of the petA transcript. Experiments involving:

  • Genetic analysis of TCA1 mutants

  • Suppressor screening

  • Reporter gene experiments with swapped 5'UTRs

have demonstrated that:

  • The petA 5'UTR contains cis-acting elements required for translation

  • Nuclear factors interact specifically with these elements to activate translation

  • This regulatory mechanism is part of the Controlled by Epistasis of Synthesis (CES) process that coordinates the expression of chloroplast proteins

Table 1: Comparison of petA regulation mechanisms across microalgae species

SpeciesRegulatory MechanismKey FactorsReference
Chlamydomonas reinhardtiiTranslational activation via 5'UTRTCA1 nuclear factor
Chlorella vulgarisNot fully characterizedLikely involves nuclear factors
Chlorella saccharophilaPost-translational regulation during stressHeat shock response pathway

These regulatory mechanisms ensure proper stoichiometry of components in the cytochrome b6f complex and coordinate nuclear-chloroplast gene expression, which is critical for photosynthetic function .

How does cytochrome f participate in stress responses and programmed cell death in microalgae?

Research has revealed an unexpected role for cytochrome f in stress responses and programmed cell death (PCD) in microalgae, particularly during heat shock response. This function extends beyond its well-established role in photosynthetic electron transport.

In Chlorella saccharophila, a psychrophilic unicellular green alga related to C. vulgaris, cytochrome f has been implicated in heat shock (HS)-induced programmed cell death through several mechanisms:

  • Transcriptional upregulation: Semi-quantitative reverse transcriptase PCR analysis demonstrated that the petA gene (ChspetA) expression is up-regulated in heat-shocked cells.

  • Subcellular relocalization: Protein analysis showed a time-dependent release of cytochrome f from thylakoid membranes into the cytosol following heat shock.

  • PCD induction: Cell suspensions treated with cytosolic extracts from heat-shocked cells (containing elevated levels of cytochrome f) exhibited hallmarks of programmed cell death including:

    • Positive Evans Blue assay (indicating membrane permeability)

    • Chromatin condensation

    • Chloroplast alterations

This research suggests that cytochrome f may function as a signaling molecule in stress-induced PCD in microalgae, similar to cytochrome c in mitochondria-mediated apoptosis in higher eukaryotes. The dual role of cytochrome f in both electron transport and stress signaling makes it an important target for understanding cellular responses to environmental stressors.

Methodologically, researchers investigating this phenomenon typically employ:

  • Differential gene expression analysis during stress conditions

  • Subcellular fractionation to monitor protein localization

  • Cellular viability assays to detect PCD markers

  • Genetic manipulation to alter cytochrome f levels or localization

These approaches provide insights into the molecular mechanisms by which photosynthetic proteins like cytochrome f mediate stress responses in microalgae .

What structural features distinguish Chlorella vulgaris cytochrome f from other photosynthetic organisms?

Cytochrome f from Chlorella vulgaris shares fundamental structural elements with homologs from other photosynthetic organisms but also possesses distinct features that may influence its function and stability. Comparative structural analysis reveals:

Conserved elements across species:

  • The heme-binding domain with the characteristic CANCH motif

  • Acidic domains that interact with plastocyanin

  • A C-terminal membrane anchor domain

  • A buried chain of five water molecules in the heme-binding large domain, which is conserved throughout plants, cyanobacteria, and green algae cytochrome f

Distinct features of C. vulgaris cytochrome f:

  • Sequence identity comparison shows 52% or more identity between cytochrome f proteins from different species including C. vulgaris, Chlamydomonas subcaudata, Brassica rapa, and Phormidium laminosum

  • Unlike some other species, the C. vulgaris cytochrome f structure lacks certain insertions observed in other algae

  • The petA gene in some related species encodes an atypical cytochrome f with unique insertions not present in other f-type cytochromes

Structural implications:
These structural differences may impact:

  • Electron transfer kinetics

  • Interaction with redox partners

  • Stability under different environmental conditions

  • Assembly into the cytochrome b6f complex

Advanced research methods used to study these structural features include:

  • X-ray crystallography

  • Protein sequence alignment and evolutionary analysis

  • Site-directed mutagenesis to probe functional regions

  • Molecular dynamics simulations to understand conformational dynamics

Understanding these structural distinctions is essential for researchers designing experiments involving recombinant cytochrome f or engineering variants with enhanced properties .

What methodological approaches can be used to study the integration of recombinant cytochrome f into functional photosynthetic complexes?

Investigating the integration of recombinant cytochrome f into functional photosynthetic complexes requires sophisticated methodological approaches spanning biochemical, biophysical, and genetic techniques. Researchers can employ the following strategies:

Chloroplast transformation and expression:

  • Homologous recombination using vectors like pCMCC with specific recombination elements (R1: 16S-trnI and R2: trnA-23S)

  • Expression under chloroplast-specific promoters such as Prrn

  • Inclusion of appropriate 5' and 3' UTRs to enhance translation efficiency

  • Verification of integration by PCR using primers flanking the integration site

Functional assembly assessment:

Table 2: Analytical methods for assessing cytochrome f integration and function

MethodInformation ObtainedTechnical Considerations
Blue-native PAGEComplex assembly and integrityRequires gentle detergent solubilization
Absorption spectroscopyHeme incorporation and protein foldingpH-dependent spectral shifts must be considered
Electron transport assaysFunctional electron transfer capabilityTemperature and light sensitivity
ImmunoblottingProtein expression levels and complex associationAntibody specificity is critical
Chlorophyll fluorescenceImpact on photosystem functionRequires intact cells or thylakoids

These methodological approaches provide complementary information about both the structural integration and functional performance of recombinant cytochrome f in photosynthetic complexes .

How can genetic engineering of the petA gene be used to enhance photosynthetic efficiency or stress tolerance?

Genetic engineering of the petA gene offers promising approaches for enhancing photosynthetic efficiency and stress tolerance in microalgae. Based on current research, several strategic modification approaches can be implemented:

Modification strategies for enhanced photosynthetic efficiency:

  • Altering electron transfer kinetics:

    • Site-directed mutagenesis of key residues in the electron transfer pathway

    • Modification of the heme environment to optimize redox potential

    • Engineering of interaction domains with redox partners like plastocyanin

  • Improving protein stability:

    • Introduction of stabilizing mutations based on comparative sequence analysis across thermophilic and psychrophilic species

    • Optimization of membrane anchor domains for enhanced complex assembly

    • Reduction of susceptibility to proteolytic degradation

  • Manipulating regulatory elements:

    • Modification of 5' UTR regions to enhance translation efficiency

    • Application of inducible or tissue-specific promoters

    • Implementation of synthetic ribosome binding sites for increased expression

Approaches for enhanced stress tolerance:

  • Heat stress resistance:

    • Engineering variants that resist cytosolic release during heat shock

    • Introduction of chaperone-binding domains to enhance folding under stress

    • Creating variants with reduced signaling capacity in programmed cell death pathways

  • Oxidative stress protection:

    • Incorporation of additional antioxidant properties

    • Engineering redox-insensitive variants

    • Modification of thiol groups susceptible to oxidative damage

Methodological framework for petA engineering:

  • Design phase:

    • In silico modeling of protein modifications

    • Phylogenetic analysis of natural variants

    • Computational prediction of stability and function

  • Implementation:

    • CRISPR/Cas9-mediated chloroplast genome editing

    • Chloroplast transformation using homologous recombination

    • Site-directed mutagenesis of expression constructs

  • Functional validation:

    • Photosynthetic performance measurement (oxygen evolution, electron transport rates)

    • Stress challenge experiments (temperature, light, oxidative stress)

    • Long-term growth and productivity assessment

This genetic engineering approach must be integrated with a comprehensive understanding of photosynthetic regulation and the specific role of cytochrome f in both energy conversion and stress signaling pathways .

What are the primary challenges in expressing functional recombinant cytochrome f and how can they be overcome?

The expression of functional recombinant cytochrome f presents several significant challenges due to its complex structure, cofactor requirements, and membrane integration. Understanding these challenges and implementing appropriate solutions is critical for successful experimental outcomes.

Main challenges and solution strategies:

  • Proper folding and heme incorporation:

    Challenges:

    • Cytochrome f requires covalent attachment of heme c via thioether bonds

    • The protein contains multiple disulfide bridges essential for stability

    Solutions:

    • Expression in specialized E. coli strains with enhanced disulfide bond formation capability

    • Co-expression with cytochrome c maturation (Ccm) proteins

    • Addition of heme precursors to the culture medium

    • Optimization of induction conditions (temperature, IPTG concentration, time)

  • Membrane integration:

    Challenges:

    • The C-terminal transmembrane domain is hydrophobic and can cause aggregation

    • Proper membrane targeting is required for functionality

    Solutions:

    • Use of detergents during purification (LDAO, β-DDM, or Triton X-100)

    • Expression as fusion proteins with solubility-enhancing tags

    • Implementation of in vitro refolding protocols

    • Design of truncated versions lacking the transmembrane domain for soluble expression

  • Expression system selection:

    Challenges:

    • Heterologous systems may lack specific chaperones or maturation factors

    • Codon usage bias can limit expression levels

    Solutions:

    • Codon optimization for the expression host

    • Chloroplast transformation for expression in native-like environment

    • Testing multiple expression systems (E. coli, yeast, insect cells)

    • Use of cell-free expression systems for difficult constructs

  • Functional validation:

    Challenges:

    • Assessing proper folding and activity outside of the native complex

    • Distinguishing between structural and functional issues

    Solutions:

    • Spectroscopic analysis to confirm heme incorporation

    • Redox potential measurements

    • In vitro electron transfer assays with purified redox partners

    • Reconstitution into liposomes or nanodiscs for functional studies

Table 3: Troubleshooting guide for recombinant cytochrome f expression

ProblemPossible CausesRecommended Solutions
Low expression yieldToxicity, codon bias, protein instabilityLower induction temperature, codon optimization, addition of protease inhibitors
Improper heme incorporationInsufficient heme availability, oxidizing environmentSupplement medium with δ-aminolevulinic acid, use reducing agents
Protein aggregationHydrophobic interactions, improper foldingAddition of appropriate detergents, co-expression with chaperones
Lack of activityImproper folding, heme oxidation, missing partnersReconstitution with cytochrome b6f components, controlled redox environment

By systematically addressing these challenges, researchers can improve the likelihood of obtaining functional recombinant cytochrome f for structural and functional studies .

What analytical techniques are most appropriate for characterizing the structure and function of recombinant Chlorella vulgaris Apocytochrome f?

A comprehensive characterization of recombinant Chlorella vulgaris Apocytochrome f requires multiple complementary analytical techniques to assess its structural integrity and functional properties. The following methodological approaches are recommended:

Structural characterization:

  • Spectroscopic methods:

    • UV-visible absorption spectroscopy: Characteristic peaks at ~550 nm (α-band) and ~522 nm (β-band) in the reduced state

    • Circular dichroism (CD): Assessment of secondary structure elements

    • Fluorescence spectroscopy: Monitoring tryptophan environments and protein folding

    • Resonance Raman spectroscopy: Detailed analysis of heme environment

  • Mass spectrometry-based approaches:

    • Intact mass analysis: Verification of correct molecular weight and post-translational modifications

    • Hydrogen-deuterium exchange MS: Probing protein dynamics and solvent accessibility

    • Cross-linking MS: Identification of interaction interfaces with redox partners

  • Structural techniques:

    • X-ray crystallography: High-resolution structural determination

    • NMR spectroscopy: Solution structure and dynamics analysis

    • Cryo-electron microscopy: Structure within larger complexes

Functional characterization:

  • Redox properties:

    • Potentiometric titrations: Determination of midpoint potential

    • Cyclic voltammetry: Electron transfer kinetics

    • Stopped-flow spectroscopy: Rapid kinetics of redox reactions

  • Binding studies:

    • Surface plasmon resonance (SPR): Interaction with redox partners

    • Isothermal titration calorimetry (ITC): Thermodynamics of binding

    • Microscale thermophoresis: Label-free interaction analysis

  • Activity assays:

    • Spectrophotometric assays: Monitoring electron transfer to artificial acceptors

    • Reconstitution assays: Integration into liposomes with other complex components

    • Oxygen evolution measurements: Impact on photosynthetic electron transport

Data integration approaches:

  • Structural bioinformatics: Comparison with homologous structures

  • Molecular dynamics simulations: Behavior in membrane environments

  • Integrative modeling: Combining data from multiple experimental techniques

These analytical approaches provide complementary information and should be selected based on specific research questions and available resources .

How can researchers optimize transformation protocols for expressing recombinant petA genes in Chlorella vulgaris chloroplasts?

Successful transformation of Chlorella vulgaris chloroplasts for petA gene expression requires optimized protocols that account for the unique characteristics of this microalga. Based on recent advances in chloroplast transformation methodology, researchers should consider the following optimization strategies:

Vector design considerations:

  • Homologous recombination elements:

    • Select appropriate flanking sequences (e.g., 16S-trnI and trnA-23S regions) for efficient integration

    • Optimize the length of homologous regions (2000-2500 bp recommended)

    • Consider the genomic context of the integration site to avoid disrupting essential genes

  • Expression cassette components:

    • Use strong chloroplast promoters (e.g., Prrn from C. reinhardtii)

    • Incorporate effective 5' UTRs (e.g., T7 phage UTR or petA native UTR)

    • Include appropriate terminators (e.g., psbA terminator)

    • Consider bicistronic arrangement with selectable markers

Transformation methodology optimization:

  • Electroporation parameters:

    • Buffer composition: Test both sorbitol-mannitol and sorbitol buffers

    • Cell density: 1-2 × 10^8 cells/mL is optimal

    • Electric field strength: 1000-2500 V/cm

    • Capacitance: 25-50 μF

    • Pulse duration: 4-10 ms

  • Selection strategy:

    • Antibiotic selection: Kanamycin (50 mg/L) with the Aph6 marker gene

    • Light conditions: Moderate light (40-60 μE m^-2 s^-1) during initial selection

    • Sequential selection: Increase antibiotic concentration gradually

  • Verification methods:

    • PCR confirmation with primers spanning integration junctions

    • Western blot analysis using antibodies against cytochrome f or epitope tags

    • Phenotypic assessment of photosynthetic parameters

Table 4: Optimization parameters for C. vulgaris chloroplast transformation

ParameterRange to TestOptimal ConditionsNotes
DNA concentration10-50 μg25-30 μgHigher concentrations may be toxic
Cell growth phaseEarly to late logMid-log phaseCells should be actively dividing
Electric field1000-2500 V/cm~2000 V/cmStrain-dependent optimization needed
Recovery time12-48 hours24 hoursDark recovery followed by dim light
Selection pressure25-100 mg/L kanamycin50 mg/L initiallyGradual increase to 100 mg/L

Troubleshooting common issues:

  • Low transformation efficiency:

    • Test different cell wall disruption methods (enzymatic treatment)

    • Optimize DNA quality and concentration

    • Ensure cells are in optimal physiological state

  • False positives:

    • Implement rigorous verification with multiple PCR primer sets

    • Perform Southern blot analysis to confirm integration

    • Test for stable inheritance through multiple generations

  • Low expression levels:

    • Optimize codon usage for chloroplast expression

    • Consider position effects in the chloroplast genome

    • Test different regulatory elements

By systematically optimizing these parameters, researchers can significantly improve the efficiency of chloroplast transformation for recombinant petA expression in Chlorella vulgaris .

What are the current limitations in understanding the regulation of petA gene expression and how can these be addressed?

Despite significant advances in our understanding of petA gene expression, several important knowledge gaps remain. Addressing these limitations requires innovative experimental approaches and new technologies that can provide deeper insights into regulatory mechanisms.

Current limitations:

  • Incomplete understanding of translational regulation:

    • While translational activators like TCA1 have been identified in model organisms like Chlamydomonas reinhardtii, the specific regulatory factors in Chlorella vulgaris remain largely uncharacterized

    • The precise cis-elements in the 5' UTR of petA mRNA that interact with regulatory proteins are not fully mapped

    • The mechanisms coordinating nuclear and chloroplast gene expression are not completely understood

  • Limited knowledge of post-translational regulation:

    • Factors affecting cytochrome f stability and turnover under different environmental conditions

    • The role of proteases in regulating cytochrome f levels

    • Mechanisms controlling the assembly of cytochrome f into the cytochrome b6f complex

  • Gaps in stress response pathways:

    • The signaling mechanisms triggering cytochrome f release during heat shock

    • The dual role of cytochrome f in electron transport and programmed cell death

    • Species-specific differences in stress response mechanisms

Methodological approaches to address these limitations:

  • Advanced genetic approaches:

    • CRISPR/Cas9-mediated chloroplast genome editing to create targeted mutations in regulatory regions

    • Creation of reporter constructs with modified 5' UTRs to map regulatory elements

    • Tethered ribonucleoprotein capture to identify RNA-binding proteins interacting with petA mRNA

  • High-throughput screening methods:

    • Ribosome profiling to monitor translation efficiency under different conditions

    • RNA-seq with different stress treatments to identify condition-specific regulation

    • Proteomics analysis of protein complexes to identify regulatory interactions

  • Single-cell and real-time analysis:

    • Single-cell RNA-seq to capture cell-to-cell variability in gene expression

    • Live-cell imaging with fluorescent reporters to monitor expression dynamics

    • FRET-based biosensors to detect protein-protein interactions in vivo

  • Integrative approaches:

    • Systems biology modeling of gene regulatory networks

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Comparative genomics across multiple algal species to identify conserved regulatory elements

Research priorities for advancing understanding:

  • Identification and characterization of trans-acting factors controlling petA translation in Chlorella vulgaris

  • Mapping of cis-regulatory elements in the petA 5' UTR using mutagenesis approaches

  • Investigation of the signaling pathways connecting environmental stress to petA regulation

  • Characterization of the molecular mechanisms controlling cytochrome f stability and turnover

By addressing these limitations through innovative methodological approaches, researchers can develop a more comprehensive understanding of petA gene regulation and its role in photosynthesis and stress responses .

How can recombinant Chlorella vulgaris Apocytochrome f be used as a tool for studying electron transport chain dynamics?

Recombinant Chlorella vulgaris Apocytochrome f represents a valuable tool for investigating the dynamics and regulation of the photosynthetic electron transport chain. By leveraging this recombinant protein, researchers can implement various experimental approaches to study fundamental aspects of photosynthetic energy conversion.

Experimental applications:

  • Reconstitution studies:

    • Incorporation of purified recombinant cytochrome f into liposomes or nanodiscs

    • Stepwise reconstitution of minimal electron transport systems

    • Comparison of wild-type and mutant variants to identify essential functional regions

  • Protein-protein interaction studies:

    • Analysis of interactions with plastocyanin, cytochrome b6, and other partners

    • Identification of binding interfaces through cross-linking and mass spectrometry

    • Characterization of transient interactions using rapid kinetic methods

  • Electron transfer kinetics:

    • Laser flash photolysis to measure electron transfer rates

    • Temperature-dependent measurements to determine activation energies

    • pH-dependent studies to assess proton-coupled electron transfer

  • Structural dynamics:

    • Time-resolved spectroscopy to capture conformational changes during electron transfer

    • Hydrogen-deuterium exchange to map dynamic regions

    • Site-directed spin labeling and EPR spectroscopy to monitor domain movements

Methodological approaches for electron transport studies:

  • In vitro systems:

    • Oxygen electrode measurements with isolated chloroplasts or reconstituted systems

    • Spectrophotometric assays using artificial electron donors and acceptors

    • Electrochemical methods to measure electron transfer properties

  • Advanced biophysical techniques:

    • Time-resolved X-ray crystallography to capture intermediate states

    • Single-molecule spectroscopy to observe individual electron transfer events

    • Atomic force microscopy to visualize complex assembly and organization

  • Genetic approaches:

    • Complementation of cytochrome f-deficient mutants with recombinant variants

    • Structure-function analysis through systematic mutagenesis

    • Creation of fusion proteins for in vivo tracking and analysis

Table 5: Experimental setup for electron transport studies using recombinant cytochrome f

By strategically employing recombinant cytochrome f in these experimental approaches, researchers can gain valuable insights into the mechanisms and regulation of photosynthetic electron transport, contributing to our fundamental understanding of energy conversion in photosynthetic organisms and potentially informing biotechnological applications .

What are the best approaches for analyzing the interaction between recombinant cytochrome f and its redox partners?

Understanding the interactions between cytochrome f and its redox partners is crucial for elucidating electron transport mechanisms. A multi-faceted approach combining biochemical, biophysical, and computational methods provides the most comprehensive analysis of these critical protein-protein interactions.

Biochemical approaches:

  • Co-immunoprecipitation and pull-down assays:

    • Use of His-tagged recombinant cytochrome f for pull-down experiments

    • Antibody-based immunoprecipitation of protein complexes

    • Analysis of co-precipitated proteins by mass spectrometry

    • Quantification of binding affinities through titration experiments

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linking of interacting proteins using reagents like BS3 or EDC

    • Identification of cross-linked peptides by LC-MS/MS

    • Mapping of interaction interfaces based on cross-linked residues

    • Zero-length cross-linking to identify direct contact points

Biophysical methods:

  • Surface plasmon resonance (SPR):

    • Immobilization of cytochrome f on sensor chips

    • Real-time monitoring of association and dissociation kinetics

    • Determination of kinetic and equilibrium binding constants

    • Analysis of the effects of pH, ionic strength, and redox state on binding

  • Isothermal titration calorimetry (ITC):

    • Measurement of thermodynamic parameters (ΔH, ΔS, ΔG)

    • Direct determination of binding stoichiometry

    • Assessment of buffer effects on binding energetics

    • Investigation of coupled processes (protonation, conformational changes)

  • Microscale thermophoresis (MST):

    • Label-free analysis of binding in solution

    • Minimal sample consumption

    • Detection of weak transient interactions

    • Compatible with membrane proteins in detergent solutions

Spectroscopic techniques:

  • Förster resonance energy transfer (FRET):

    • Site-specific labeling of cytochrome f and partners with fluorophores

    • Measurement of inter-protein distances in solution

    • Real-time monitoring of complex formation

    • Single-molecule FRET for dynamic analysis

  • Electron paramagnetic resonance (EPR):

    • Spin labeling of key residues at the interface

    • Determination of distance constraints between labels

    • Analysis of local environment changes upon binding

    • Investigation of the effects of redox state on protein dynamics

Computational methods:

  • Molecular docking:

    • Generation of binding mode predictions

    • Ranking of potential interaction interfaces

    • Integration with experimental constraints

    • Assessment of electrostatic complementarity

  • Molecular dynamics simulations:

    • Analysis of complex stability over time

    • Identification of key stabilizing interactions

    • Characterization of conformational changes during binding

    • Calculation of binding free energies

Integrated experimental strategy:

For optimal characterization of cytochrome f interactions, a sequential approach is recommended:

  • Initial screening using pull-down assays to identify interaction partners

  • Biophysical characterization (SPR, ITC) to determine binding parameters

  • Structural analysis through cross-linking MS and spectroscopic methods

  • Computational modeling to integrate experimental data and generate comprehensive interaction models

  • Functional validation through electron transfer kinetics measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.