Recombinant Chlorella vulgaris ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C or -80°C. The default glycerol concentration we provide is 50% and can be used as a reference.
Shelf Life
Shelf life can vary depending on factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Chlorella vulgaris (Green alga)
Target Names
atpI
Target Protein Sequence
MTNIWFDVAEVSVGQHWYWQLGGYSLHGQVLITSWIVVAVIGVICLLGTQNLQPVSGGSA ATAPKGLQNLTEYITEFIRDLAKTQIGEEDYLKWVPFLGTIFLFIFVSNWSGALIPWRIL ELPNGELAAPTNDINTTVALALLTSIAYFYAGISKKGLGYFKRYISPAAFLLPINILEDL TKPLSLSFRLFGNILADELVVGVLVSLVPLVVPIPIMLLGLFTSAIQALVFATLAGAYIG ESVEDHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a plays a crucial role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the ATP synthase complex function in Chlorella vulgaris chloroplasts?

The ATP synthase in Chlorella vulgaris chloroplasts operates through a sophisticated chemiosmotic mechanism. The enzyme complex consists of two major components: the membrane-embedded F0 sector (containing subunit a among others) and the stromal-facing F1 sector. During photosynthesis, light-driven electron transport creates a proton gradient across the thylakoid membrane. These protons flow through the F0 sector, specifically through the interface between subunit a and the c-ring .

This proton movement induces rotation of the c-ring, which is mechanically coupled to the rotation of the γ-stalk in the F1 region. The γ-rotation drives conformational changes in the α3β3 head, catalyzing the synthesis of ATP from ADP and inorganic phosphate. For every complete rotation of the c-ring, three ATP molecules are produced, with the number of protons required dependent on the number of c-subunits in the ring .

Research shows that ATP synthase (subunit beta) was significantly upregulated (3.2-fold change) in Chlorella sorokiniana under mixotrophic culture conditions, highlighting the importance of energy metabolism adaptability in Chlorella species .

What are the optimal expression systems for producing recombinant Chlorella vulgaris ATP synthase subunit a?

The production of recombinant Chlorella vulgaris ATP synthase subunit a presents significant challenges due to its hydrophobic nature and membrane localization. Based on successful approaches with similar proteins, the following expression systems are recommended:

  • Escherichia coli system with fusion partners: Expression of atpI as a fusion protein with solubility-enhancing partners such as maltose binding protein (MBP) has proven effective for similar membrane proteins. The hydrophobic atpI can be expressed as a soluble MBP-fusion protein, then cleaved and purified using chromatography techniques .

  • Co-expression with chaperones: Including molecular chaperones such as DnaK, DnaJ, and GrpE significantly increases yields of recombinant membrane proteins that are typically difficult to produce. The pOFXT7KJE3 plasmid system has been successfully employed for similar proteins .

  • Codon optimization: Using a codon-optimized gene insert adapted for the expression host improves translation efficiency and protein yield, which is particularly important for cross-kingdom expression of eukaryotic proteins in prokaryotic hosts .

For optimal results, expression should be performed in BL21 derivative E. coli strains (such as T7 Express lysY/Iq) with temperature control (typically 18-25°C for membrane proteins) to balance expression rate with proper folding .

What purification strategies are most effective for isolating recombinant atpI protein?

Purification of recombinant Chlorella vulgaris ATP synthase subunit a requires specialized approaches due to its hydrophobic properties. A multi-step purification strategy is recommended:

  • Initial capture using affinity chromatography: If expressed with an affinity tag (His-tag or MBP), use corresponding affinity resins for initial capture from cell lysates. For MBP fusion proteins, amylose resin provides good selectivity .

  • Protease cleavage: When using fusion partners, employ site-specific proteases (such as Factor Xa or TEV protease) to cleave the target protein from its fusion partner under optimized conditions that prevent aggregation .

  • Reversed-phase chromatography: Highly hydrophobic membrane proteins like atpI can be effectively purified using reversed-phase columns with appropriate detergent systems and organic solvent gradients .

  • Storage considerations: The purified protein should be stored in a buffer containing 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week .

For quality control, circular dichroism spectroscopy can confirm the correct alpha-helical secondary structure expected for this membrane protein .

What methods can be used to assess the structural integrity of purified recombinant atpI?

Several complementary techniques can effectively evaluate the structural integrity of purified recombinant Chlorella vulgaris ATP synthase subunit a:

  • Circular Dichroism (CD) Spectroscopy: This technique measures the differential absorption of left and right circularly polarized light, providing information about secondary structure content. For atpI, which should exhibit predominantly alpha-helical structure, CD spectra showing characteristic minima at 208 nm and 222 nm would confirm proper folding .

  • Fourier Transform Infrared Spectroscopy (FTIR): This can provide additional structural information, particularly for membrane proteins in lipid environments. The amide I band (1600-1700 cm-1) is sensitive to secondary structure elements.

  • Limited Proteolysis combined with Mass Spectrometry: This approach can identify properly folded domains that resist proteolytic degradation versus misfolded regions that are more accessible to proteases.

  • Thermal Stability Assays: Techniques such as differential scanning calorimetry (DSC) or differential scanning fluorimetry (DSF) can assess protein stability and proper folding by measuring thermal denaturation profiles.

  • Native Gel Electrophoresis: Running purified protein on blue native PAGE can assess oligomeric state and structural integrity in near-native conditions with appropriate detergent systems.

The combination of these methods provides a comprehensive assessment of whether the recombinant protein maintains its native-like structure after the purification process .

How can researchers assess the functionality of recombinant atpI in reconstituted systems?

Evaluating the functionality of recombinant Chlorella vulgaris ATP synthase subunit a requires reconstitution into membrane systems that mimic its native environment. The following methodologies are recommended:

  • Proteoliposome Reconstitution: Incorporate purified atpI along with other ATP synthase subunits into liposomes with lipid compositions resembling thylakoid membranes. This allows for assessment of proton channel formation and functionality.

  • Proton Translocation Assays: Measure proton flux across reconstituted proteoliposomes using pH-sensitive fluorescent dyes (such as ACMA or pyranine) to assess if the reconstituted atpI facilitates proton movement.

  • Patch-Clamp Electrophysiology: This technique can directly measure ion conductance through the reconstituted protein in artificial membrane systems, providing detailed functional characterization of proton channel properties.

  • ATP Synthesis Coupling Assays: In fully reconstituted systems containing all necessary ATP synthase components, measure ATP production upon generation of an artificial proton gradient to assess if the recombinant atpI supports complete functional assembly.

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry analysis can verify proper interaction between atpI and other subunits, particularly the c-ring, which is essential for function.

These functional assays should be performed alongside positive controls using native ATP synthase complexes to benchmark the activity of the recombinant system .

Which residues in Chlorella vulgaris atpI are critical for proton translocation, and how can they be experimentally identified?

Critical residues in Chlorella vulgaris ATP synthase subunit a involved in proton translocation can be identified through systematic analysis:

  • Sequence Conservation Analysis: Multiple sequence alignment of atpI across species reveals evolutionarily conserved residues likely crucial for function. In ATP synthase subunit a, highly conserved arginine residues and polar/charged residues in transmembrane regions are typically essential for proton channel formation and function.

  • Site-Directed Mutagenesis Approach:

    • Generate a library of atpI variants with alanine substitutions at conserved charged/polar residues

    • Express these mutants using the optimized recombinant expression system

    • Reconstitute mutant proteins into liposomes for functional testing

    • Assess proton translocation efficiency using pH-sensitive fluorescent probes

  • Hydrogen/Deuterium Exchange Mass Spectrometry: This technique can identify residues accessible to the aqueous environment, potentially forming the proton translocation pathway.

  • Molecular Dynamics Simulations: Computational methods can predict water-accessible channels and identify residues likely involved in proton transfer based on the amino acid sequence provided .

Experimental validation of critical residues should include both loss-of-function and gain-of-function studies to definitively establish their role in proton translocation .

How do mutations in atpI affect ATP synthase assembly and function in Chlorella vulgaris?

Mutations in atpI can have profound effects on ATP synthase assembly and function, as demonstrated by studies on similar systems:

  • Assembly Defects: Severe mutations in atpI can prevent proper integration of the protein into the ATP synthase complex. This can be assessed using blue native PAGE and immunoblotting to visualize incomplete assembly intermediates. Research on ATP synthase mutants has shown that peripheral stalk components are essential for proper assembly of the complete complex .

  • Proton Leakage Effects: Mutations in the proton channel-forming regions may lead to uncoupled proton translocation, where protons flow without driving ATP synthesis. This can be measured by simultaneously monitoring proton gradient formation and ATP synthesis rates in reconstituted systems.

  • Growth Phenotypes Under Different Conditions:

    • Photosynthetic growth (autotrophic conditions) is severely impaired when ATP synthase function is compromised

    • Heterotrophic and mixotrophic growth may show different degrees of impairment depending on the severity of the mutation

  • Compensatory Mechanisms: Metabolomic and proteomic analyses of ATP synthase mutants reveal upregulation of alternative energy-generating pathways. For example, studies in Chlorella species show that under different trophic modes, cells can adapt their metabolism to compensate for changes in energy production .

The analysis of atpI mutations should include comprehensive phenotyping using multiple approaches to fully understand the impact on both ATP synthase structure and cellular physiology .

How does atpI interact with other ATP synthase subunits in Chlorella vulgaris?

The interaction of atpI (subunit a) with other ATP synthase components in Chlorella vulgaris involves specific structural arrangements crucial for function:

  • Interaction with the c-ring: This is the most critical interaction for atpI, forming the functional interface for proton translocation. The interface between subunit a and the c-ring creates two offset half-channels that allow protons to access the protonation sites on c-subunits, driving rotation. This interaction can be studied using:

    • Chemical crosslinking followed by mass spectrometry

    • Förster resonance energy transfer (FRET) with fluorescently labeled subunits

    • Cryo-electron microscopy of reconstituted complexes

  • Interaction with peripheral stalk components: Studies in Chlamydomonas reinhardtii (another green alga) have demonstrated that peripheral stalk subunits (AtpF and ATPG) are essential for ATP synthase biogenesis and stability. Mutations in these genes prevent ATP synthase accumulation, suggesting critical structural interactions with atpI .

  • Assembly pathway mapping: The sequential assembly of ATP synthase components can be mapped using inducible expression systems for atpI combined with time-course analysis of complex formation. This approach can reveal which interactions form early versus late in the assembly process.

Understanding these interactions provides insights into both the functional mechanism and evolutionary adaptations of the ATP synthase complex in photosynthetic organisms .

What techniques can determine the stoichiometry and arrangement of atpI within the complete ATP synthase complex?

Several complementary techniques can determine the stoichiometry and spatial arrangement of atpI within the ATP synthase complex:

  • Cryo-Electron Microscopy (cryo-EM): This technique can resolve the structure of membrane protein complexes at near-atomic resolution, revealing the number and arrangement of subunits. Recent advances in single-particle cryo-EM make this particularly suitable for large complexes like ATP synthase.

  • Mass Photometry: This emerging technique measures the mass of individual protein complexes in solution, allowing precise determination of stoichiometry without requiring crystallization or extensive sample preparation.

  • Quantitative Crosslinking Mass Spectrometry (QCLMS): By using isotopically labeled crosslinkers, researchers can quantitatively assess the abundance of specific subunit interactions, providing insights into both stoichiometry and arrangement.

  • Native Mass Spectrometry: This can determine the intact mass of the entire ATP synthase complex and its subcomplexes, providing direct evidence of subunit stoichiometry.

  • FRET-Based Distance Measurements: By strategically labeling specific sites on atpI and other subunits, researchers can map the three-dimensional arrangement of components using distance constraints derived from FRET efficiency measurements.

These techniques should be used in combination, as each provides different and complementary information about complex composition and structure .

How does the expression of atpI change under different growth conditions in Chlorella vulgaris?

The expression and regulation of ATP synthase subunit a (atpI) in Chlorella vulgaris varies significantly across different growth conditions:

  • Trophic Mode-Dependent Regulation:

    • Under mixotrophic conditions, ATP synthase components show significant upregulation. For example, ATP synthase subunit beta (another component of the complex) exhibited a 3.2-fold increase in mixotrophic cultures of the related species Chlorella sorokiniana .

    • Autotrophic conditions maintain baseline expression levels of ATP synthase components as they are essential for photosynthetic ATP production.

    • Heterotrophic conditions show varied responses depending on carbon source availability.

  • Light Intensity Effects:

    • High light conditions trigger acclimation responses that include modulation of photosynthetic and energy-generating components. Under high light, cells must balance energy capture with ATP synthesis capacity .

    • Low light conditions typically maintain steady expression of ATP synthase components to maximize energy capture efficiency.

  • Stress Response Patterns:

    • Nutrient limitation studies have shown that ATP synthase expression is maintained even under stress conditions, highlighting its essential role in cellular energy metabolism.

The proteomic analysis of Chlorella species under different growth conditions reveals that ATP synthase components are part of a broader metabolic adaptation strategy that involves coordinated changes in multiple energy-generating pathways .

What role does atpI play in the bioenergetic adaptations of Chlorella vulgaris to environmental changes?

ATP synthase subunit a (atpI) plays a crucial role in the bioenergetic adaptations of Chlorella vulgaris to changing environmental conditions:

  • Proton Gradient Management: As a key component of the proton channel, atpI helps regulate the dissipation of the proton gradient across the thylakoid membrane. This regulation is critical when cells transition between different light intensities or trophic modes .

  • Energy Balance Optimization:

    • In mixotrophic conditions, cells must balance photosynthetic and respiratory energy generation. Upregulation of ATP synthase components (including atpI) helps maximize ATP production from both processes .

    • During high light exposure, increased ATP synthase activity prevents over-reduction of the photosynthetic electron transport chain by accelerating proton utilization for ATP synthesis .

  • Metabolic Network Integration:

    • The ATP synthase complex interacts functionally with other metabolic pathways. For example, NAD(P)H fluorescence measurements in Chlorella cells show the interconnection between photosynthetic electron transport, ATP synthesis, and NAD(P)H/NAD(P)+ ratios .

    • These connections facilitate rapid metabolic adjustments to environmental fluctuations.

  • Evolutionary Adaptation: The ATP synthase c-ring stoichiometry (which works in conjunction with atpI) varies between species, affecting the proton-to-ATP ratio. This variability likely represents evolutionary adaptations to different energetic requirements and environmental niches .

These adaptations highlight the central role of ATP synthase in coordinating cellular energy metabolism across varying environmental conditions .

How can recombinant atpI be used to investigate the structural basis of proton-to-ATP ratio variations across species?

Recombinant Chlorella vulgaris ATP synthase subunit a (atpI) provides a powerful tool for investigating the structural determinants of proton-to-ATP ratios across species:

  • Chimeric atpI Construction:

    • Generate hybrid atpI proteins containing domains from species with different c-ring stoichiometries

    • Express and purify these chimeric proteins using optimized recombinant methods

    • Reconstitute with native c-rings to identify regions responsible for determining c-ring/atpI interaction specificity

  • Interface Residue Mapping:

    • The amino acid sequence of Chlorella vulgaris atpI can be compared with sequences from organisms having different c-ring stoichiometries

    • Mutagenesis of interface residues followed by functional reconstitution can identify specific residues that influence c-ring stoichiometry

  • Cryo-EM Structural Analysis:

    • High-resolution structural determination of reconstituted atpI with c-rings of different stoichiometries

    • This approach can reveal how structural adaptations in atpI accommodate different c-ring sizes

  • Biophysical Measurements of Proton Channel Properties:

    • Electrophysiological characterization of reconstituted atpI-containing proteoliposomes

    • Measurement of proton conductance properties with different c-ring partners to understand how atpI influences proton transfer efficiency

These approaches can help resolve the long-standing question of how ATP synthase complexes evolved different proton-to-ATP ratios to meet the specific bioenergetic demands of different organisms and cellular compartments .

What biotechnological applications could be developed using engineered variants of Chlorella vulgaris atpI?

Engineered variants of Chlorella vulgaris ATP synthase subunit a (atpI) offer several promising biotechnological applications:

  • Enhanced Biofuel Production Systems:

    • Engineered atpI variants that optimize the proton-to-ATP ratio could improve energy conversion efficiency in photosynthetic microalgae

    • This could lead to increased lipid or carbohydrate accumulation for biofuel production, as Chlorella species are already recognized for their lipid production potential

  • Bioactive Peptide Development:

    • Proteomic analysis has shown that membrane proteins from Chlorella can yield bioactive peptides with various therapeutic activities

    • Specific peptide fragments derived from atpI could be evaluated for activities including antioxidative, antihypertensive, or antimicrobial properties

  • Biosensors for Proton Gradient Measurement:

    • Engineered atpI variants with incorporated fluorescent reporters could serve as sensitive biosensors for measuring proton gradient formation in artificial membrane systems

    • These could have applications in drug screening platforms targeting membrane transporters

  • Minimal ATP Synthase Systems:

    • Development of simplified, reconstituted ATP synthase systems using recombinant atpI and minimal partner proteins

    • Such systems could serve as platforms for studying energy conversion mechanisms or as components in synthetic biology applications

  • Nanomotor Development:

    • The ATP synthase complex functions as a natural nanomotor

    • Engineered atpI variants could contribute to the development of bionanotechnology applications using modified ATP synthase complexes as mechanical nanomachines

These applications leverage both the fundamental roles of atpI in bioenergetics and the biotechnological potential of Chlorella vulgaris as a versatile microalgal platform .

How do post-translational modifications affect atpI function in Chlorella vulgaris?

Post-translational modifications (PTMs) of ATP synthase subunit a (atpI) in Chlorella vulgaris represent an emerging area of research with significant implications for protein function:

  • Phosphorylation Dynamics:

    • While specific phosphorylation sites on Chlorella vulgaris atpI have not been conclusively mapped, studies in related photosynthetic organisms suggest that phosphorylation of ATP synthase components occurs in response to changing environmental conditions

    • Potential phosphorylation sites can be predicted from the amino acid sequence using bioinformatic tools, with serine, threonine, and tyrosine residues in hydrophilic regions being primary candidates

    • These modifications likely regulate ATP synthase activity in response to light intensity changes and metabolic fluctuations

  • Oxidative Modifications:

    • The redox state of chloroplasts changes dramatically during light/dark transitions and under stress conditions

    • Cysteine residues in atpI may undergo reversible oxidation, potentially serving as redox sensors that modulate protein function

    • Targeted mass spectrometry approaches can identify these modifications and their functional consequences

  • Lipid-Protein Interactions:

    • As a membrane protein, atpI function is influenced by the surrounding lipid environment

    • Specific lipid interactions may constitute a form of post-translational regulation

    • Lipidomic analysis combined with protein crosslinking can identify specific lipid associations that modulate atpI function

  • Proteolytic Processing:

    • N-terminal or C-terminal processing may occur during atpI integration into the thylakoid membrane

    • Such processing could be developmentally regulated or condition-dependent

Investigation of these modifications requires advanced proteomic techniques including enrichment strategies for membrane proteins and targeted mass spectrometry approaches .

What computational approaches can predict the impact of mutations on atpI function and ATP synthase efficiency?

Advanced computational approaches offer powerful tools for predicting how mutations in atpI affect ATP synthase function in Chlorella vulgaris:

  • Homology Modeling and Molecular Dynamics:

    • Using the provided amino acid sequence , homology models of Chlorella vulgaris atpI can be constructed based on known structures from other organisms

    • Molecular dynamics simulations (100+ nanosecond timescales) can reveal:

      • Proton channel formation and dynamics

      • Water molecule positioning within the channel

      • Effects of mutations on channel geometry and proton accessibility

    • These simulations should account for the membrane environment using appropriate lipid compositions

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Approaches:

    • For studying proton transfer events at atomic resolution

    • Can model proton jumping between water molecules and key residues in the channel

    • Helps identify rate-limiting steps in proton translocation that might be affected by mutations

  • Machine Learning Integration:

    • Trained on existing mutagenesis data from ATP synthase in multiple organisms

    • Can predict the functional impact of novel mutations in atpI

    • Feature extraction from sequence conservation patterns improves prediction accuracy

  • Systems Biology Modeling:

    • Integration of atpI mutations into genome-scale metabolic models of Chlorella vulgaris

    • Predicts how changes in ATP synthase efficiency propagate through the entire metabolic network

    • Identifies potential compensatory pathways that might be activated in response to ATP synthase deficiencies

  • Coevolutionary Analysis:

    • Identifies coevolving residue networks within atpI and between atpI and interacting subunits

    • Predicts which residue combinations must change together to maintain function

    • Particularly valuable for designing functional chimeric proteins

These computational approaches provide both mechanistic insights and practical guidance for experimental design in atpI research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.