Recombinant Chlorella vulgaris Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorella vulgaris Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Chlorella vulgaris Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex, which is essential for photosynthetic electron transfer in plants and algae . In Chlorella vulgaris, a species of green algae, the petD subunit plays a critical role in the function and stability of this complex . The recombinant form of this protein is produced using an in vitro E. coli expression system, allowing for detailed study and manipulation .

Characteristics and Features

FeatureDescription
Product CodeCSB-CF348051DSP
Sourcein vitro E. coli expression system
SpeciesChlorella vulgaris (Green alga)
Uniprot No.P56322
Protein NamesRecommended name: Cytochrome b6-f complex subunit 4; Alternative name(s): 17 kDa polypeptide
Gene NamespetD
Expression Region1-160
SequenceMAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDP AAIGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLLTVPFIENINKF QNPFRRPVATTVFLIGTVAAIWLGIGAALPIDISLTLGLF
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
StorageStore at -20°C, conserve at -20°C or -80°C for extended storage. Avoid repeated freezing and thawing .

Function of Cytochrome b6-f Complex

The cytochrome b6-f complex is a vital component of the photosynthetic electron transport chain. Its primary functions include:

  1. Electron Transfer: It mediates the transfer of electrons from plastoquinol to plastocyanin, facilitating the flow of electrons between Photosystem II and Photosystem I .

  2. Proton Translocation: The complex contributes to the generation of a proton gradient across the thylakoid membrane, which is essential for ATP synthesis .

  3. Regulation of Photosynthetic Efficiency: The cytochrome b6-f complex is involved in regulating photosynthetic electron flow to optimize energy production and prevent over-reduction of the electron transport chain .

Research Findings

  • Purification and Characterization: The cytochrome b6-f complex has been successfully purified and characterized from various organisms, including Chlamydomonas reinhardtii . These studies have provided insights into its subunit composition, structure, and electron transfer mechanisms .

  • Role in Heat Shock Response: In Chlorella saccharophila, cytochrome f, another component of the complex, is implicated in the heat shock response pathway. Heat stress induces the release of cytochrome f into the cytosol, triggering programmed cell death .

  • Regulation of Electron Flow: The complex is also involved in cyclic electron flow (CEF) around Photosystem I, which is crucial for balancing the ATP/NADPH ratio and protecting the photosynthetic apparatus under stress conditions .

Applications of Recombinant petD

  1. Biochemical Studies: Recombinant petD enables detailed biochemical analyses, such as protein-protein interaction studies, mutational analyses, and investigation of electron transfer mechanisms.

  2. Structural Biology: The recombinant protein can be used for structural studies to determine the three-dimensional structure of the cytochrome b6-f complex and understand its function at the molecular level.

  3. Biotechnology: Recombinant petD can be employed in biotechnological applications, such as developing biosensors or improving photosynthetic efficiency in algae for biofuel production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Chlorella vulgaris (Green alga)
Target Names
petD
Target Protein Sequence
MAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDPA AIGEPANPFATPLEILPEWYFYPVFQILRVVPNKLLGVLLMAAVPAGLLTVPFIENINKF QNPFRRPVATTVFLIGTVAAIWLGIGAALPIDISLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of the cytochrome b6-f complex in Chlorella vulgaris, and what role does the PetD subunit play?

    The cytochrome b6-f complex is a multi-subunit membrane protein complex that plays a central role in photosynthetic and respiratory electron transport in microalgae such as Chlorella vulgaris. It functions as a dimer of large complexes, with each complex composed of multiple subunits.

    PetD (subunit IV) is one of the four large subunits of the cytochrome b6-f complex, alongside cytochrome f, cytochrome b6, and the Rieske iron-sulfur protein. It mediates electron transfer between photosystem II (PSII) and photosystem I (PSI) . Research indicates that PetD is essential for the stability and assembly of the complex, as it forms a mildly protease-resistant subcomplex with cytochrome b6 that serves as a template for the assembly of other components .

    The complex has been studied in detail in various organisms, revealing that:

    • It functions primarily as a dimer

    • PetD becomes unstable in the absence of Cyt b6

    • The synthesis of Cyt f is greatly reduced when either Cyt b6 or PetD is inactivated

    This indicates that both Cyt b6 and PetD are prerequisites for the synthesis of Cyt f, explained by the CES (controlled by epistasy of synthesis) mechanism where the synthesis rate of chloroplast-encoded subunits is regulated by the availability of their assembly partners.

  • What techniques are used for successfully transforming Chlorella vulgaris chloroplasts with recombinant petD?

    Transformation of C. vulgaris chloroplasts with recombinant petD involves several techniques, with electroporation being one of the most effective methods. Based on recent research, the process typically includes:

    • Design of a species-specific chloroplast expression vector (such as pCMCC) containing:

      • Homologous recombination elements (R1 and R2 regions)

      • Appropriate promoter (e.g., Prrn promoter)

      • Selection marker (e.g., Aph6 for kanamycin resistance)

      • Untranslated regions (UTRs)

      • Codon-optimized gene of interest

    • Electroporation parameters using carbohydrate-based buffers:

      • Sorbitol-mannitol buffer (SM) or sorbitol buffer (S)

      • With or without light exposure during electroporation (L or NL)

    Research has shown that successful transformation can be verified through:

    • PCR confirmation (producing specific amplicon sizes, e.g., 2.8-kb)

    • Growth on selective media (e.g., f/2 agar plates with 50 mg/L kanamycin)

    • Western blot analysis to confirm protein expression

    Results from recent studies demonstrate that different buffer conditions can affect transformation efficiency, with evidence suggesting that both sorbitol-mannitol and sorbitol methods can yield viable transformants .

  • How can researchers optimize codon usage for recombinant petD expression in Chlorella vulgaris?

    Optimizing codon usage is crucial for efficient expression of recombinant proteins in C. vulgaris. Based on current research methodologies, the optimization process should include:

    1. Codon Adaptation Index (CAI) optimization: Aim for a high CAI value (e.g., 0.96 as achieved in some studies) to maximize translation efficiency .

    2. GC content adjustment: Optimal GC content for C. vulgaris expression is typically around 40-45% (43.8% has been reported as successful) . This helps in:

      • Maximizing RNA stability

      • Enhancing translation rates

      • Preventing secondary structure formation that could impede translation

    3. Elimination of rare codons: Replace rare codons with synonymous codons that are more frequently used in the C. vulgaris chloroplast genome.

    4. Removal of potential regulatory sequences: Eliminate sequences that might interfere with gene expression, such as:

      • Cryptic splice sites

      • Premature polyadenylation signals

      • Internal ribosome entry sites

    5. Bioinformatic validation: Use specialized software to verify the optimized sequence before synthesis.

    Researchers have reported that codon optimization can significantly increase protein yields, as demonstrated in studies where various recombinant proteins were successfully expressed in C. vulgaris using this approach .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.