Recombinant Chlorella vulgaris Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The psbB gene encodes CP47, a 47 kDa chlorophyll-binding protein integral to PSII’s core structure. CP47 forms part of the inner light-harvesting antenna system, working alongside CP43 (encoded by psbC) to transfer excitation energy to the PSII reaction center (P680) . In Chlorella vulgaris, this protein is essential for photosynthetic efficiency under varying light conditions.

Key Functions:

  • Light Harvesting: Binds chlorophyll a and transfers energy to the reaction center .

  • Structural Stabilization: Maintains the integrity of PSII’s core complex, particularly in protecting the oxygen-evolving complex (OEC) .

  • Regulatory Role: Interacts with extrinsic OEC proteins (e.g., PsbO, PsbP) to modulate PSII activity .

Production Methods

Recombinant psbB production typically involves heterologous expression systems. For Chlorella vulgaris, chloroplast transformation is a key strategy:

Chloroplast Expression Workflow:

  1. Vector Construction:

    • Homologous Recombination Regions: trnI (16S rRNA) and trnA (23S rRNA) flanking regions for site-specific integration .

    • Promoter: Prrn (from Chlamydomonas reinhardtii) drives expression .

    • Marker: Aph6 (kanamycin resistance) for selection .

  2. Transformation:

    • Electroporation with sorbitol-mannitol or sorbitol buffers enhances cell membrane permeability .

  3. Purification:

    • His-tagged proteins are purified via nickel affinity chromatography .

Challenges:

  • Post-Transcriptional Processing: psbB mRNA requires splicing (group II introns in petB/petD) and stability factors (e.g., HCF107 in plants) for translation .

  • Host Limitations: Chlorella lacks native psbB processing factors, necessitating engineered vectors or co-expression systems.

Research Applications

ApplicationDetails
Structural BiologyCryo-EM studies to resolve PSII subunit interactions (e.g., PsbB-PsbU) .
BiotechnologyProduction of chlorophyll-binding proteins for biofuels or photodynamic therapy .
Stress ToleranceEngineering Chlorella with recombinant psbB to enhance drought/salt resistance .

Key Findings:

  • PSII Assembly: CP47 interacts with PsbH (encoded by psbH) and PsbT to stabilize the Q<sub>B</sub> site .

  • OEC Protection: PsbU-PsbB interactions in Chlorella prevent oxidative damage during photoinhibition .

Comparative Analysis of psbB Across Organisms

OrganismUniProt IDSourceTagPurityReference
Spinacia oleraceaP04160E. coliHis>90%
Chara vulgarisQ1ACH5Mammalian cellsN/A>85%
Cyanophora paradoxaP48103E. coliN/A>90%
Chlorella vulgarisChloroplastHis (predicted)

Notes: Data for Chlorella vulgaris psbB remains sparse, with most studies focusing on heterologous systems.

Future Directions

  1. Chloroplast Engineering: Optimizing psbB expression cassettes for Chlorella using endogenous promoters.

  2. Stress-Resistant Strains: Co-expressing psbB with antioxidant genes to enhance photoprotection.

  3. Industrial Applications: Leveraging Chlorella as a biofactory for chlorophyll-protein production.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Chlorella vulgaris (Green alga)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTSLVSGWAGSMAFYELAVFDPSDPVLNPMWRQGM FVLPFMTRLGITQSWGGWTISGETAANPGVWSYEGVAAAHIVLSGLLFAASIWHWVYWDL ELFRDPRTSNPALDLPKIFGIHLFLSGVLCFGFGAFHVTGIFGPGIWVSDPYGITGTVQA VAPSWDATGFDPYNPGGISAHHIAAGILGVLAGLFHLCVRPPQRLYNGLRMGNIETVLSS SIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDLGFFQQEIERRVQTNLSEGKSASQ AWAEIPEKLAFYDYIGNNPAKGGLFRAGAMNSGDGIAVGWLGHAVFKEKQGNELFVRRMP TFFETFPVVLVDKDGVVRADVPFRRSESKYSIEQVGVSVTFYGGELDGVTFNDPATVKKY ARRAQLGEIFEFDRATLQSDGVFRASPRGWFTFAHLCFALLFFFGHIWHGARTIFRDVFA GIDADLDEQVEFGAFLKLGDTSTRRQSV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the core complex in photosystem II (PSII). It binds chlorophyll and actively participates in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, harnessing light energy to abstract electrons from H₂O, generating O₂ and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein and what role does it play in Photosystem II?

The CP47 chlorophyll apoprotein (encoded by the psbB gene) is a crucial component of Photosystem II (PSII), serving as one of the core antenna proteins. This protein binds multiple chlorophyll molecules and plays a vital role in light harvesting and energy transfer to the reaction center of PSII. In Chlorella species, as in other photosynthetic organisms, CP47 contributes to the structural integrity of the PSII complex and facilitates efficient photosynthesis by optimizing light-capturing capabilities.

The protein is also known by several synonyms including "photosystem II 47 kDa protein," "Photosystem II CP47 reaction center protein," "photosystem II P680 chlorophyll A apoprotein," and "PSII 47 kDa protein" . Its molecular structure includes multiple transmembrane domains that anchor it within the thylakoid membrane of the chloroplast.

How does recombinant psbB protein differ from native protein in Chlorella vulgaris?

Recombinant psbB protein is typically produced in heterologous expression systems such as E. coli, as seen in commercially available products . While the amino acid sequence aims to match the native protein, several key differences exist:

  • Post-translational modifications: Native CP47 undergoes specific modifications in Chlorella that may be absent or different in recombinant versions

  • Protein folding: The cellular environment of E. coli differs significantly from that of chloroplasts, potentially affecting tertiary structure

  • Cofactor binding: Native CP47 is assembled with chlorophyll molecules in vivo, while recombinant versions may lack proper pigment integration

  • Functional integration: Recombinant CP47 is isolated from its natural protein complex partners, affecting its functional properties

These differences must be considered when using recombinant proteins for experimental studies as they may impact structural analysis, functional assays, and antibody recognition.

What methods are used to study CP47 function in Photosystem II?

Several methodological approaches are used to investigate CP47 function in Photosystem II:

What is the relationship between CP47 and environmental stress responses in Chlorella?

CP47 and the broader Photosystem II complex are highly sensitive to environmental stressors. Studies on Chlorella species demonstrate that PSII activity, which depends partly on CP47 function, is significantly affected by various environmental conditions:

  • Heavy metal exposure: Research on Chlorella pyrenoidosa shows that chromium (Cr VI) exposure significantly reduces PSII quantum yield (measured as Fv/Fm). This inhibitory effect increases with higher chromium concentrations and is particularly pronounced in light conditions, suggesting that the stress effect is linked to photosynthetic activity

  • Light conditions: The inhibitory effect of stressors like chromium on PSII is negligible in dark conditions, indicating that either stress uptake is light-dependent or the inhibitory effect requires active photosynthesis

  • Thermoluminescence changes: Environmental stressors alter the thermoluminescence profile of Chlorella cells. For example, chromium treatment progressively decreases the intensity of the B and Q bands in thermoluminescence measurements, indicating damage to the charge recombination pathways in PSII

These stress responses highlight the vulnerability of CP47 and associated PSII components to environmental perturbations, making them potential biomarkers for environmental monitoring.

What transformation systems can be used to modify the psbB gene in Chlorella chloroplasts?

Chloroplast transformation in Chlorella vulgaris requires specialized approaches due to the unique characteristics of algal chloroplasts. Current methodologies include:

Electroporation-based transformation: This approach has been successfully employed for chloroplast transformation in Chlorella vulgaris. A specific plastid expression vector (pCMCC - Chula Mexico Chlorella chloroplast) has been designed to express recombinant genes in C. vulgaris chloroplasts . The transformation protocol involves:

  • Using carbohydrate-based buffers during electroporation to improve transformation efficiency

  • Targeting the semi-autonomous replicating chloroplast organelle for genetic engineering

  • Incorporating species-specific promoters and regulatory elements to ensure proper expression

For successful chloroplast transformation targeting genes like psbB, the vector design must include:

  • Homologous flanking regions for targeted integration into the chloroplast genome

  • Strong chloroplast-specific promoters (often derived from highly expressed chloroplast genes)

  • Appropriate 5' and 3' untranslated regions for message stability and translation efficiency

  • Selectable markers that function in chloroplasts (often antibiotic resistance genes)

The pCMCC vector system demonstrates that chloroplast transformation is achievable in Chlorella vulgaris, opening possibilities for targeted modification of photosynthetic genes including psbB .

How can researchers analyze the effects of psbB mutations on PSII efficiency?

Analyzing the effects of psbB mutations requires a multi-parameter approach to fully characterize changes in PSII function:

  • Thermoluminescence (TL) analysis: This technique provides detailed information about electron transport within PSII. By exciting Chlorella cells with "white light" (approximately 50 μmol m⁻² s⁻¹) for 30 seconds at -80°C, researchers can induce TL bands that correspond to specific charge recombination events:

    • B band (maximum at ~32°C): Represents recombination between the S₂ state of the water-splitting complex and reduced QB

    • Q band (maximum at ~15°C): Observed in the presence of DCMU, represents recombination between the S₂ state and QA⁻

  • Protein expression quantification: Western blotting with antibodies against D1 protein (which forms a complex with CP47) can be used to assess PSII integrity following psbB mutation. The protein amounts can be quantified using densitometric analysis

  • Fluorescence induction kinetics: Analysis of the polyphasic rise of chlorophyll fluorescence (OJIP transients) provides information about various steps of electron transport and can reveal specific blockages caused by psbB mutations

  • Oxygen evolution measurements: Quantitative analysis of photosynthetic oxygen production under different light intensities can reveal functional impacts of psbB modifications

A comprehensive analysis would collect data using these methods under various growth conditions (different light intensities, temperature regimes, nutrient states) to fully characterize the phenotypic effects of psbB mutations.

What interactions exist between the CP47 protein and other components of the photosynthetic apparatus?

CP47 engages in multiple critical interactions within the photosynthetic machinery:

  • D1/D2 proteins: CP47 forms an integral part of the PSII reaction center complex through direct interactions with the D1 and D2 proteins. These interactions help position chlorophyll molecules optimally for energy transfer to the reaction center

  • Water-splitting complex: CP47 has structural and functional relationships with the oxygen-evolving complex (OEC), as evidenced by thermoluminescence studies showing charge recombination between the S₂ state and electron acceptors

  • Electron transport chain components: The function of CP47 affects downstream electron transport, as demonstrated by studies using DCMU (which blocks electron transport between QA and QB) to alter thermoluminescence patterns in Chlorella

  • Light-harvesting complexes: CP47 interfaces with peripheral antenna complexes, facilitating energy transfer from outer light-harvesting systems to the PSII reaction center

  • PsbO, PsbP, and PsbQ proteins: CP47 interacts with these extrinsic proteins that stabilize the manganese cluster involved in water oxidation

Understanding these interactions provides insights into how mutations in psbB might affect the broader photosynthetic apparatus through altered protein-protein contacts.

What methodological approaches are most effective for isolating native CP47 protein from Chlorella species?

Isolation of native CP47 protein from Chlorella requires specialized techniques to maintain structural integrity and function:

Recommended isolation protocol:

  • Cell disruption:

    • Optimize cell breakage methods (sonication, French press, or bead-beating) for Chlorella's rigid cell wall

    • Use isotonic buffers supplemented with protease inhibitors to prevent protein degradation

  • Membrane isolation:

    • Differential centrifugation to isolate thylakoid membranes (typically 10,000×g for chloroplasts, followed by 40,000-100,000×g for thylakoids)

    • Resuspension in stabilizing buffer containing glycerol to preserve membrane integrity

  • Solubilization:

    • Carefully titrate mild detergents (n-dodecyl β-D-maltoside or digitonin) to solubilize membrane proteins while preserving complexes

    • Maintain low temperature (0-4°C) throughout the process

  • Purification:

    • Sucrose gradient ultracentrifugation to separate protein complexes

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography as a final polishing step

  • Verification:

    • Western blot analysis with CP47-specific antibodies

    • Mass spectrometry for protein identification

    • Absorption spectroscopy to confirm chlorophyll association

When comparing this native protein with recombinant CP47 (such as products like MBS7027354) , researchers should note that native preparations will contain associated chlorophyll molecules and potentially other PSII components, which are typically absent in recombinant versions expressed in E. coli.

How does CP47 structure and function differ between Chlorella vulgaris and other green algae?

While the fundamental role of CP47 is conserved across photosynthetic organisms, there are species-specific variations that affect research approaches:

Comparison table of CP47 characteristics across algal species:

CharacteristicChlorella vulgarisChara vulgarisChlorella pyrenoidosaChlamydomonas reinhardtii
Cellular locationSingle chloroplast with or without pyrenoids Complex chloroplastsSingle chloroplastSingle cup-shaped chloroplast
Response to stressModerately sensitive to environmental stressorsLess studiedHighly sensitive to chromium stress Well-characterized stress responses
Genetic accessibilityChloroplast transformation possible with specialized vectors Limited tools availableSimilar to C. vulgarisHighly developed genetic tools
Antibody cross-reactivityVariableLowHigh with C. vulgarisAntibodies raised against C. reinhardtii D1 work for Chlorella species
Thermoluminescence profileSpecies-specific bandsNot well documentedB band at ~32°C; Q band at ~15°C Well characterized

These differences highlight the importance of species-specific approaches when studying CP47, especially when translating methodologies between model organisms like Chlamydomonas and less-studied species like Chlorella.

How can recombinant psbB protein be used to develop antibodies for photosystem research?

Recombinant psbB protein serves as an excellent antigen source for developing specific antibodies that can be used in photosystem research:

  • Immunization protocol optimization:

    • Use highly purified recombinant CP47 (such as MBS7027354) as the immunogen

    • Select adjuvants carefully to maximize immunogenicity while minimizing non-specific responses

    • Implement a strategic immunization schedule with appropriate booster doses

  • Antibody characterization:

    • Test cross-reactivity with CP47 from multiple Chlorella species and other algae

    • Validate antibody specificity using knockout or reduced-expression lines

    • Determine optimal working concentrations for different applications (Western blotting, immunofluorescence, etc.)

  • Applications in photosystem research:

    • Quantify CP47 levels under various stress conditions

    • Track PSII assembly and turnover during photoinhibition

    • Study CP47 localization within the chloroplast using immunogold electron microscopy

Researchers should note that antibodies raised against the recombinant protein may recognize different epitopes than those accessible in the native protein complex, potentially affecting their utility in certain applications.

What are the most promising research directions for understanding psbB gene regulation in Chlorella?

Several cutting-edge research directions hold particular promise for understanding psbB regulation:

  • Chloroplast-targeted transcriptomics:

    • Analyze chloroplast-specific gene expression changes under various environmental conditions

    • Identify transcription factors and regulatory elements controlling psbB expression

    • Compare regulation between different Chlorella species to identify conserved mechanisms

  • Proteomics approaches:

    • Study post-translational modifications of CP47 under different light conditions

    • Characterize CP47 turnover rates during photoinhibition and recovery

    • Identify interaction partners that may regulate CP47 stability

  • Synthetic biology applications:

    • Design artificial promoters and regulatory elements to control psbB expression

    • Use the pCMCC plastid expression vector system to introduce modified versions of psbB

    • Engineer optimized PSII complexes with enhanced stress tolerance

  • Comparative genomics:

    • Analyze evolutionary conservation of psbB sequence and regulatory elements across green algae

    • Identify species-specific features that may correlate with ecological adaptations

    • Study horizontal gene transfer events involving photosynthetic genes

These research directions can be pursued using advanced tools like the chloroplast transformation system developed for Chlorella vulgaris, which allows precise genetic manipulation of photosynthetic genes .

How can studies of CP47 in Chlorella contribute to understanding photoinhibition mechanisms?

Photoinhibition—the light-induced damage to PSII—is a fundamental limitation to photosynthetic efficiency. CP47 studies in Chlorella can provide valuable insights into this process:

  • Light-dependent damage assessment:

    • Studies with chromium stress demonstrate that PSII damage in Chlorella is strongly light-dependent

    • This parallels photoinhibition mechanisms, suggesting shared pathways

  • D1 protein turnover correlation:

    • CP47 stability is linked to D1 protein levels, which can be monitored via Western blot analysis

    • Tracking both proteins simultaneously can reveal the sequence of PSII complex disassembly during photoinhibition

  • Thermoluminescence signatures:

    • The specific patterns of thermoluminescence bands (B and Q bands) provide mechanistic insights into electron transport disruption

    • Changes in these patterns during high light exposure can identify the specific electron transfer steps most vulnerable to photodamage

  • Recovery mechanisms:

    • Monitoring CP47 reassembly during recovery from photoinhibition can reveal repair mechanisms

    • Comparing wild-type and genetically modified Chlorella strains can identify factors affecting PSII repair efficiency

Understanding these mechanisms has both fundamental importance and practical applications for enhancing photosynthetic efficiency in biotechnological applications of microalgae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.