Recombinant Chlorella vulgaris Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

  • PQ-Binding Domain: The C-terminal region (residues ~200–344) contains motifs critical for plastoquinone interaction .

  • Transmembrane Helices: Predicted α-helical structures align with PSII core architecture .

PSII Assembly and Biogenesis

The Q(B) protein is essential for the formation of the D1/D2 heterodimer, a core component of the PSII reaction center. Studies in Synechocystis and land plants reveal that:

  • RubA (Rubredoxin-like protein) binds to D1 mod (mature D1) and facilitates RCII (reaction center II) assembly .

  • PsbU and PsbP stabilize the oxygen-evolving complex in Chlorella ohadii, preventing photodamage .

Chloroplast Expression Systems

The psbA gene (encoding the Q(B) protein) serves as a regulatory element in chloroplast vectors. For example:

  • Chlorella vulgaris chloroplast vectors use the psbA terminator to drive expression of heterologous genes (e.g., bFGF), achieving yields of 0.26–1.42 ng/g biomass .

  • Codon Optimization: The psbA terminator enhances mRNA stability and translation efficiency in transplastomic systems .

Challenges and Future Directions

  • Low Yield in Chloroplasts: Despite successful expression of recombinant proteins (e.g., bFGF), yields remain suboptimal (0.005–0.4% of total soluble proteins) .

  • Improvement Strategies:

    • Promoter Optimization: Testing alternative promoters (e.g., salt-inducible promoters) to enhance expression .

    • Co-expression with Chaperones: RubA or CyanoP homologs may improve folding and stability of the Q(B) protein .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Chlorella vulgaris (Green alga)
Target Names
psbA
Target Protein Sequence
TAILERRESASLWARFCEWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFFL GICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several downstream electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of QB protein in Photosystem II of Chlorella vulgaris?

QB (quinone B) functions as the exchangeable plastoquinone electron acceptor in Photosystem II. In C. vulgaris, as in other photosynthetic organisms, QB accepts electrons from QA and, after receiving two electrons and undergoing protonation, forms QBH2 (plastohydroquinone) which dissociates from the binding site and enters the plastoquinone pool within the thylakoid membrane .

The redox potential values for QB in photosystem II are critical to its function. Research has measured the midpoint potentials of QB:

  • EQ<sub>B</sub>/Q<sub>B</sub><sup>- −</sup> ≈ 90 mV

  • EQ<sub>B</sub><sup>- −</sup>/Q<sub>B</sub>H<sub>2</sub> ≈ 40 mV

These values reveal that:

  • The semiquinone Q<sub>B</sub><sup>- −</sup> is thermodynamically stabilized

  • The difference between EQ<sub>B</sub>/Q<sub>B</sub>H<sub>2</sub> (∼65 mV) and EPQ/PQH<sub>2</sub> (∼117 mV) creates a driving force (ΔE ≈ 50 meV) for Q<sub>B</sub>H<sub>2</sub> release into the quinone pool

  • Plastoquinone binds approximately 50 times more tightly than plastohydroquinone

How does the QB protein structure in C. vulgaris compare to other photosynthetic organisms?

The QB binding site in C. vulgaris Photosystem II shares substantial homology with other photosynthetic organisms, especially other green algae. The binding site is primarily formed by the D1 protein along with interactions from the non-heme iron.

Research indicates that the bicarbonate anion serves as an important cofactor that binds to the non-heme iron positioned between the QA and QB plastoquinone electron acceptors . This bicarbonate-iron-quinone complex is essential for optimal electron transfer. Studies in cyanobacteria (Synechocystis sp. PCC 6803) have shown that various proteins, including PsbT, modify the bicarbonate-binding environment, which likely applies to C. vulgaris as well .

What techniques are available for studying QB protein function in C. vulgaris?

Several experimental approaches can be employed to study QB protein function:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Used to detect and characterize the semiquinone intermediate (Q<sub>B</sub><sup>- −</sup>) and measure redox potentials

  • Thermoluminescence Measurements: Provides functional estimates of the energy gap between QA and QB redox potentials

  • Formate Inhibition Assays: Formate competes with bicarbonate for binding to the non-heme iron, enabling study of bicarbonate binding strength and its effect on electron transfer

  • Oxygen Evolution Measurements: Quantifies PSII activity and can reveal impairments in QB function

  • Fluorescence Induction and Relaxation: Monitors electron transfer kinetics from QA to QB

Recently, researchers have identified that parameters related to non-photochemical dissipation, electron transport, and integrative performance are the most sensitive indicators for assessing damage to the QB binding region, as determined by Principal Component Analysis (PCA) .

What expression systems are currently available for producing recombinant Photosystem II proteins in C. vulgaris?

Several transformation and expression systems have been developed for C. vulgaris:

  • Nuclear Transformation:

    • The pCCVG vector system utilizes flanking sequences from the nitrate reductase (NR) gene of C. vulgaris for integration by double homologous recombination

    • The cauliflower mosaic virus 35S promoter (CaMV 35S) has been used successfully

    • Nitrogen deficiency-inducible promoters from C. vulgaris (CvNDI1 and CvNDI2) provide conditional expression

    • DNA geminiviral vectors with Rep-mediated replication have been used for transient expression

  • Chloroplast Transformation:

    • The pCMCC vector targets the chloroplast genome of C. vulgaris using long homologous sequences (trnI/trnA) to mediate site-directed insertion

    • The Prrn promoter from Chlamydomonas reinhardtii has been validated for expression in C. vulgaris chloroplasts

    • Selectable markers include Aph6 (conferring kanamycin resistance)

  • Salt-Inducible Systems:

    • Salt-inducible promoters (SIP) have been identified in C. vulgaris and incorporated into expression vectors

How can I optimize transformation efficiency for recombinant QB protein expression in C. vulgaris?

Optimization strategies for C. vulgaris transformation include:

  • Pretreatment of Cells:

    • Osmotic buffer treatment (200 mM D-sorbitol, 200 mM D-mannitol) for 1 hour at room temperature increases transformation efficiency

    • Both sorbitol-mannitol and sorbitol buffers have proven effective for electroporation

  • Transformation Parameters for Electroporation:

    • Optimal conditions: 0.75 kV, 50 μF capacitance, and 200 Ω resistance with a 2-mm cuvette

    • After electroporation, immediate addition of fresh medium is crucial for cell recovery

  • Selection Strategy:

    • Plating transformed cells on media containing appropriate antibiotics (e.g., 50 mg/L kanamycin)

    • For chloroplast transformation, initial selection on low antibiotic concentration followed by increasing concentration helps isolate homoplasmic transformants

  • Codon Optimization:

    • Codon adaptation to C. vulgaris codon usage significantly improves expression levels

    • Aim for a codon adaptation index of >0.9 with appropriate GC content (~40-45%) for optimal mRNA stability and translation rate

  • Promoter Selection:

    • For constitutive expression: CaMV 35S promoter

    • For inducible expression: CvNDI promoters (nitrogen deficiency) or SIP (salt induction)

What are the key differences between chloroplast and nuclear transformation for QB protein studies?

FeatureChloroplast TransformationNuclear Transformation
Integration MethodHomologous recombination (precise)Random integration or homologous recombination
Copy NumberHigh (multiple chloroplast genomes)Usually low (1-few copies)
Expression LevelGenerally higherGenerally lower
Protein TargetingNative to chloroplastRequires transit peptide for chloroplast targeting
Gene SilencingRareCommon issue
Post-translational ModificationsLimitedMore extensive
InheritanceMaternal (non-Mendelian)Mendelian
Suitable for Photosystem ProteinsIdeal (native environment)Requires additional targeting sequences

For QB protein studies, chloroplast transformation offers several advantages:

  • The protein is expressed in its native environment

  • Higher expression levels can be achieved

  • Co-expression with other photosystem components is possible

  • Proper folding and assembly into the photosystem complex is more likely

What are the most effective methods for isolating intact Photosystem II complexes containing recombinant QB protein from C. vulgaris?

Several approaches have been validated for isolating PSII complexes:

  • Affinity Chromatography:

    • His-tag purification: Adding a polyhistidine tag to PsbQ protein (a component of PSII) allows isolation of intact PSII complexes

    • The PsbQ-tagged PSII complexes exhibit higher activity and stability compared to those isolated using other tagged proteins

  • Differential Centrifugation and Sucrose Gradient:

    • Cell disruption using glass beads or sonication in a buffer containing protease inhibitors

    • Sequential centrifugation to separate thylakoid membranes

    • Solubilization of membranes with appropriate detergents (e.g., β-dodecyl maltoside or n-dodecyl-β-D-maltoside)

    • Sucrose gradient ultracentrifugation to separate PSII complexes

  • Blue Native PAGE:

    • Allows separation of intact protein complexes while maintaining native protein-protein interactions

    • Can be followed by second-dimension SDS-PAGE for subunit analysis

For optimal results, all isolation procedures should be performed under dim green light and at low temperature (4°C) to minimize photodamage to the PSII complexes.

What analytical techniques are most informative for characterizing recombinant QB protein function?

Several techniques provide valuable information about QB protein structure and function:

  • Oxygen Evolution Measurements:

    • Clark-type oxygen electrode measurements quantify PSII activity

    • Comparison of oxygen evolution rates with different electron acceptors can reveal QB-specific defects

  • Chlorophyll Fluorescence Analysis:

    • OJIP transients reveal electron transfer kinetics from QA to QB

    • Fluorescence decay kinetics after a single turnover flash directly measures QB reduction rates

    • Measuring fluorescence in the presence of DCMU (blocks QB binding) vs. normal conditions reveals QB contribution

  • EPR Spectroscopy:

    • Detects semiquinone intermediates (QA<sup>- −</sup> and QB<sup>- −</sup>)

    • Measures distance between cofactors and redox potentials

  • FTIR Spectroscopy:

    • Monitors QB<sup>- −</sup> formation upon illumination during redox titrations

    • Provides insights into protonation events during QB reduction

  • Mass Spectrometry:

    • Identifies post-translational modifications and protein-protein interactions

    • Cross-linking MS can map the QB binding environment

How can I assess the functional integrity of recombinant QB protein in isolated PSII complexes?

Several assays can determine whether recombinant QB protein is functionally integrated into PSII complexes:

  • Oxygen Evolution Assays:

    • Measure oxygen evolution rates using artificial electron acceptors

    • Higher rates indicate better QB function and PSII integrity

    • PsbQ-tagged PSII complexes typically show higher activity (>1000 μmol O2/mg Chl/h) compared to other isolation methods

  • Electron Transfer Inhibition Studies:

    • Compare electron transfer in the presence and absence of specific inhibitors:

      • DCMU (blocks QB binding site)

      • Formate (displaces bicarbonate from the non-heme iron)

    • Reduced sensitivity to inhibitors may indicate alterations in the QB binding site

  • Manganese Content Analysis:

    • The presence of 4 Mn atoms per PSII reaction center indicates intact oxygen-evolving complex

    • Atomic absorption spectroscopy or EPR can quantify Mn content

  • Bicarbonate Binding Assays:

    • Sensitivity to formate inhibition and reversal by bicarbonate addition reveals the integrity of the bicarbonate-iron-quinone complex

    • Functional PSII shows >80% recovery of activity upon bicarbonate addition after formate inhibition

  • Thermoluminescence Measurements:

    • The temperature and amplitude of the B-band (arising from S2QB<sup>- −</sup> recombination) provides information about QB binding and energetics

How do mutations in the QB binding site affect electron transfer in C. vulgaris Photosystem II?

Mutations in the QB binding site can affect several aspects of electron transfer:

What stress conditions specifically affect QB protein function in recombinant C. vulgaris systems?

Several stress conditions particularly impact QB function:

  • High Light Intensity:

    • Accelerates photoinhibition and D1 protein degradation

    • Back electron flow and charge recombination between QA<sup>- −</sup> and various S states of the water-oxidizing complex generate reactive oxygen species

    • The rate of D1 protein degradation is slower than PSII photoinactivation, creating a pool of non-functional PSII centers

  • Pharmaceutical Contaminants:

    • Carbamazepine (CBZ) specifically inhibits electron transport from QA to QB

    • Causes decreased number of active reaction centers

    • Triggers adaptive responses including increased non-photochemical quenching (NPQ) and chlorophyll b synthesis

  • Heavy Metal Exposure:

    • Inhibits PSII photosynthesis through multiple mechanisms

    • Different heavy metals show varying effects on growth versus photosynthesis inhibition

    • Cu and Ni exposure significantly impact photosynthesis efficiency through QB interactions

  • Carbon Source Variations:

    • Shifts between autotrophic, photoheterotrophic, and mixotrophic growth affect the photosystem protein profile

    • SDS-PAGE analysis shows significant changes in protein expression patterns, particularly in the 10-25 kDa and 28-116 kDa ranges

    • Heat shock proteins (Hsp70, Hsp90) accumulate under photoheterotrophic conditions in C. vulgaris

How can I distinguish between defects in QB binding versus other PSII components in recombinant systems?

Differentiating QB-specific defects from other PSII issues requires targeted analyses:

  • Electron Acceptor Specificity:

    • Measure oxygen evolution with different electron acceptors:

      • Ferricyanide (accepts from multiple sites)

      • DCBQ (2,6-dichloro-p-benzoquinone, predominantly QB site)

      • DMBQ (2,6-dimethyl-p-benzoquinone, predominantly QB site)

    • QB-specific defects will show normal activity with ferricyanide but reduced activity with DCBQ/DMBQ

  • DCMU Sensitivity:

    • DCMU blocks electron transfer at the QB site

    • Similar electron transfer rates in the presence and absence of DCMU indicate a pre-existing QB defect

  • Formate/Bicarbonate Effects:

    • Enhanced sensitivity to formate inhibition indicates weakened bicarbonate binding

    • Complete restoration of activity by bicarbonate addition suggests the QB binding site is intact but the bicarbonate cofactor is affected

  • Thermoluminescence Glow Curves:

    • The Q band (from S2QA<sup>- −</sup> recombination) versus B band (from S2QB<sup>- −</sup> recombination)

    • Altered B/Q band ratio indicates specific QB binding issues

  • Fluorescence Decay Kinetics:

    • Fast phase (100-200 μs): QA<sup>- −</sup> reoxidation by QB

    • Middle phase (1-2 ms): QA<sup>- −</sup> reoxidation by QB in centers where QB needs to bind first

    • Slow phase (1-30 s): back-reactions in centers where QB is inactive

    • Relative amplitude changes in these phases can pinpoint QB-specific problems

How do bacterial-algal interactions affect QB protein expression and function in C. vulgaris?

Recent research has revealed complex interactions between bacteria and C. vulgaris that affect photosynthesis and potentially QB function:

  • Enhanced CO2 Fixation:

    • Three bacterial strains (Microbacterium sp., Aeromonas sp., and Bacillus sp.) significantly enhance CO2 fixation in C. vulgaris

    • Microbacterium sp. produces indole-3-acetic acid (IAA) that promotes phosphoglycolate phosphatase activity in Chlorella

    • Bacillus sp. produces both IAA and vitamin B12, improving photosynthetic efficiency

  • Extracellular Organic Compounds:

    • Excitation-emission matrix (EEM) testing shows significant differences in extracellular organic compounds between Chlorella monocultures and bacteria-algae co-cultures

    • These compounds likely include substances that directly or indirectly affect photosystem function

  • Nutrient Exchange:

    • Bacteria secrete small amounts of nutrients (e.g., vitamin B12, trace elements) that can be used for Chlorella growth

    • These nutrients help maintain Chlorella viability and prevent cell death in nutrient-limited or acidic environments

    • This nutrient exchange may stabilize PSII function including QB activity under stress conditions

Understanding these interactions offers potential strategies to improve recombinant protein production and stability in C. vulgaris photosystems.

What are the molecular mechanisms underlying the increased susceptibility of PSII to photodamage when QB function is impaired?

When QB function is compromised, PSII becomes more susceptible to photodamage through several interconnected mechanisms:

  • Back-Reaction Pathways:

    • Impaired electron transfer from QA to QB increases the lifetime of QA<sup>- −</sup>

    • This promotes charge recombination between QA<sup>- −</sup> and the S2/S3 states of the oxygen-evolving complex

    • These recombination events can lead to the formation of chlorophyll triplet states (³Chl*) and subsequent singlet oxygen (¹O2) production

  • Decreased Photochemical Quenching:

    • Inefficient QB reduction limits the quenching of excitation energy through photochemistry

    • This increases the probability of alternative energy dissipation pathways that can generate reactive oxygen species

  • Destabilization of the Bicarbonate-Iron-Quinone Complex:

    • The bicarbonate binding to the non-heme iron between QA and QB is critical for proper electron transfer

    • Weakened bicarbonate binding (as seen in PsbT deletion mutants) leads to increased photodamage

    • This effect can be prevented by the addition of external bicarbonate, which restores the proper binding environment

  • D1 Protein Degradation Kinetics:

    • The rate of D1 protein degradation is slower than the rate of PSII photoinactivation

    • This creates a pool of photoinactivated PSII centers with damaged but not yet degraded D1 protein

    • The degradation of D1 becomes the rate-limiting step in the PSII repair cycle

How can we leverage chlorophyll-deficient C. vulgaris mutants for improved recombinant QB protein studies?

Chlorophyll-deficient mutants of C. vulgaris offer several advantages for recombinant protein studies, including QB protein research:

  • Reduced Chlorophyll Content Without Compromising Growth:

    • Yellow mutant (MT01): 80% decrease in chlorophyll content

    • White mutant (MT02): 99% decrease in chlorophyll content

    • The MT01 mutant maintains growth performance similar to wild type (5.84 g/L compared to 6.06 g/L) under heterotrophic conditions

  • Enhanced Protein Content:

    • MT02: 48.7% protein content (60% increase compared to wild type)

    • MT01: 39.5% protein content (30% increase compared to wild type)

    • Higher protein content may lead to improved yields of recombinant proteins

  • Modified Pigment Composition:

    • MT01 contains primarily lutein (a xanthophyll) responsible for its yellow color

    • MT02 contains only phytoene (colorless) as its carotenoid

    • Reduced pigmentation minimizes light absorption competition and photodamage risk

  • Experimental Advantages:

    • Reduced chlorophyll fluorescence background improves signal-to-noise ratio in fluorescence-based assays

    • Easier visualization of fluorescent reporter proteins

    • Potentially reduced photoinhibition during experimental manipulations

  • Strategic Applications:

    • The MT01 strain is particularly promising as it maintains normal growth while offering increased protein content and reduced chlorophyll interference

    • Light sensitivity of MT02 (cannot grow under 100 μmol m<sup>-2</sup> s<sup>-1</sup> light) indicates a more severely impaired photosynthetic apparatus, making it suitable for heterotrophic production systems

What is the current state of knowledge on bioactive peptides derived from C. vulgaris photosystem proteins?

Recent bioinformatics analyses have identified potential bioactive peptides within photosynthesis-related proteins from C. vulgaris, including Photosystem I P700 chlorophyll a apoprotein A2:

  • Peptide Bioactivities:

    • In silico digestion with proteolytic enzymes revealed up to 17 distinct bioactivities

    • Key activities include: ACE inhibition, dipeptidyl peptidase inhibition, antioxidative effects, glucose uptake stimulation, and antibacterial properties

  • Physicochemical Properties:

    • Most identified peptides are low molecular weight

    • Typically mildly acidic

    • Moderately water-soluble

    • Analysis using ToxinPred showed most peptides are non-toxic

  • Antibacterial Potential:

    • Database of Antimicrobial Activity and Structure of Peptides (DBAASP) prediction identified potent antibacterial peptides within photosystem proteins

    • The majority of top-ranked peptides are predicted to be non-allergenic

  • Research Implications:

    • These findings present a less labor-intensive method for discovering therapeutic targets from C. vulgaris

    • Similar approaches could be applied specifically to QB protein to identify bioactive peptides with unique properties

    • This represents an untapped research direction with potential applications in antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.