Recombinant Chlorella vulgaris Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sulfate Transport

CysT functions as part of an ABC transporter complex (CysAWTP) that imports sulfate/thiosulfate into cells . Key insights include:

  • Mechanism: Collaborates with CysW (permease) and CysA (ATPase) to translocate sulfate across membranes .

  • Regulation: In proteobacteria, transcription of cysT is activated by the CysB protein under sulfur-limiting conditions .

  • Evolutionary Conservation: Homologs exist in cyanobacteria (e.g., Synechocystis PCC 6803) and green algae (e.g., Helicosporidium sp.), though plastid-encoded cysT is rare in vascular plants .

Biotechnological Production

Expression and Purification

  • Vector Design: Utilizes codon-optimized sequences and species-specific promoters (e.g., CvNDI1/2) for efficient expression in Chlorella or E. coli .

  • Yield: Typical yields range from 0.1–1.0 mg/mL post-reconstitution .

  • Tagging: His tag facilitates affinity chromatography .

Optimization Challenges

  • Stability: Requires glycerol (5–50%) to prevent aggregation during storage .

  • Scale-Up: Electroporation-based chloroplast transformation in C. vulgaris enhances recombinant protein yields .

Research Applications

  • Sulfate Transport Studies: Used to dissect sulfate uptake mechanisms in algae and cyanobacteria .

  • Bioremediation: Potential role in sulfur cycling in aquatic ecosystems .

  • Biopharmaceuticals: Chlorella-based platforms (e.g., pCMCC vector) leverage CysT homologs for producing therapeutic proteins like bFGF .

Key Research Findings

Study FocusKey OutcomeSource
CysT in CyanobacteriaOperon organization (sbpA-ssr2439-cysT-cysW-cysA) conserved across species .
Transport KineticsHigh-affinity sulfate binding (Km = 0.1–36 μM) .
Chloroplast EngineeringSuccessful integration of cysT homologs into C. vulgaris plastomes using homologous recombination .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve transmembrane topology.

  • Metabolic Engineering: Enhancing sulfate uptake in algae for biofuel production .

  • Ecological Impact: Assessing CysT’s role in sulfur metabolism under environmental stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Chlorella vulgaris (Green alga)
Target Names
cysT
Target Protein Sequence
MKRYPTFIKNSILLFYFFFLLILPVVVLFLLIFQNNWHEVLRKATDPIAVSAYLLTVQMA FYAALVNSIFGFIITWVLTRYQFWGREFLDAAVDLPFALPTSVAGLTLATVYGDQGWIGS LFNLFGFQIVFTKIGVLLAMIFVSFPFVIRTLQPVLQEMEKSLEEAAWSLGASSWETFRK VILPTLWPALFTGFTLSFSRALGEFGSIVMISSNLPFKDLVASVLIYQSLEQYDYLGASV IGAVVLLIALFTLLLINAFQIMKFRV
Uniprot No.

Target Background

Function
This protein is a component of the ABC transporter complex cysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the function of CysT in Chlorella vulgaris?

CysT is one of the integral membrane components of the sulfate permease system in photosynthetic organisms like Chlorella vulgaris. It works alongside other components to facilitate sulfate transport across the cytoplasmic membrane. CysT contains a high proportion of nonpolar amino acids (approximately 61.5%), which is typical of membrane transport proteins, allowing it to form part of a channel through which sulfate ions pass . The protein spans the lipid bilayer of the membrane and works in conjunction with other proteins like CysW to create a functional transport channel. Mutations in cysT result in the inability to transport sulfate efficiently, demonstrating its essential role in sulfur acquisition .

How does CysT interact with other components of the sulfate transport system?

The sulfate transport system in photosynthetic microorganisms typically consists of four primary components: a substrate-binding protein located in the periplasmic space (SbpA), two integral membrane proteins (CysT and CysW) that form a channel across the cytoplasmic membrane, and an ATP-binding protein (CysA) associated with the inner face of the membrane .

CysT interacts with CysW to form the transmembrane channel, while the ATP-binding protein (CysA) provides energy through ATP hydrolysis to drive active transport. The periplasmic binding protein captures sulfate from the environment and delivers it to the membrane complex. Experimental evidence from cyanobacteria shows that mutations in any of these components can severely impair or completely eliminate sulfate uptake capability .

What is the molecular structure of CysT in Chlorella vulgaris?

Based on homology with similar proteins in cyanobacteria, CysT in Chlorella vulgaris is predicted to be a hydrophobic polypeptide of approximately 278-280 amino acids with a molecular mass of around 30 kDa . The protein contains multiple membrane-spanning regions that anchor it within the cytoplasmic membrane.

When comparing the CysT protein across species, there is significant conservation, with approximately 42% identity in amino acid sequence between cyanobacterial CysT and the analogous protein from E. coli . This conservation suggests that the structure and function of CysT have been maintained throughout evolution, highlighting its fundamental importance in sulfur metabolism across diverse photosynthetic organisms.

What strategies can be employed for recombinant expression of CysT in Chlorella vulgaris chloroplasts?

For recombinant expression of CysT in C. vulgaris chloroplasts, researchers can adopt a synthetic biology approach similar to that used for other proteins. Based on successful chloroplast transformation methods, a species-specific chloroplast expression vector can be constructed with the following components:

  • Homologous recombination elements: Long flanking sequences (>2000 bp) from the C. vulgaris chloroplast genome, such as regions surrounding the trnI and trnA genes, which mediate site-directed insertion without disrupting endogenous genes .

  • Promoter and regulatory elements: The Prrn promoter from C. reinhardtii has proven effective in C. vulgaris chloroplast expression systems .

  • Selection marker: The Aph6 gene conferring kanamycin resistance can be utilized in a bicistronic arrangement with the cysT gene .

  • Codon optimization: The cysT gene sequence should be optimized for expression in C. vulgaris chloroplasts, aiming for a codon adaptation index of >0.95 and appropriate GC content (around 40-45%) to maximize RNA stability and translation efficiency .

The expression vector can be delivered using electroporation with appropriate buffers (sorbitol-mannitol or sorbitol-based), as demonstrated successful for other recombinant proteins in C. vulgaris .

How do mutations in the cysT gene affect sulfate uptake and growth in photosynthetic microorganisms?

Studies in cyanobacteria have shown that mutations in the cysT gene have profound effects on sulfate metabolism. When cysT is interrupted by insertion of a drug resistance marker, the resulting mutant strains become non-viable when grown with sulfate as the sole sulfur source . This indicates that CysT is essential for sulfate transport and cannot be compensated for by other cellular mechanisms.

Interestingly, while cysT mutants cannot grow on sulfate, they may retain some ability to grow on alternative sulfur sources. For example, unlike cysA mutants that show no growth on thiosulfate, cysT mutants may exhibit slow growth when provided with thiosulfate . This suggests that while CysT is absolutely required for sulfate uptake, it may play a different or supplementary role in the transport of other sulfur-containing compounds.

The table below summarizes the comparative growth phenotypes observed in sulfate transport mutants:

Gene MutationGrowth on SulfateGrowth on ThiosulfateGrowth on Cysteine
Wild-typeNormalNormalNormal
cysT mutantNo growthSlow growthNormal
cysW mutantNo growthSlow growthNormal
cysA mutantNo growthNo growthNormal

These differential growth phenotypes provide valuable insights into the specialized roles of different components of the sulfate transport system .

What protocols are recommended for isolating and purifying recombinant CysT from Chlorella vulgaris for structural and functional studies?

Isolating and purifying membrane proteins like CysT presents unique challenges due to their hydrophobic nature. A comprehensive protocol would include:

  • Cell disruption:

    • Harvest transformed C. vulgaris cells by centrifugation (5,000 × g, 10 min, 4°C)

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5 mM EDTA, 1 mM PMSF, protease inhibitor cocktail)

    • Disrupt cells using French press (15,000 psi) or sonication (10 cycles of 10s on/20s off)

  • Membrane fraction isolation:

    • Remove unbroken cells and debris by centrifugation (10,000 × g, 15 min, 4°C)

    • Ultracentrifuge supernatant (100,000 × g, 1 h, 4°C) to pellet membrane fraction

    • Resuspend membrane pellet in solubilization buffer

  • Protein solubilization:

    • Solubilize membranes using a detergent screen (e.g., n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin)

    • Typical condition: 1% detergent in 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 10% glycerol

    • Incubate with gentle agitation for 2 h at 4°C

  • Affinity purification (if histidine-tagged):

    • Apply solubilized fraction to Ni-NTA resin pre-equilibrated with wash buffer

    • Wash extensively to remove non-specifically bound proteins

    • Elute CysT with imidazole gradient (50-500 mM)

  • Size exclusion chromatography:

    • Further purify eluted fractions by gel filtration (Superdex 200)

    • Collect and analyze fractions containing CysT

  • Functional verification:

    • Reconstitute purified CysT in liposomes

    • Assess sulfate transport activity using radioactive sulfate (35S) uptake assays

For structural studies, maintaining protein stability throughout purification is critical. Consider screening multiple detergents and buffer conditions to optimize protein stability and homogeneity.

How can researchers design experiments to measure sulfate transport activity in wild-type versus recombinant CysT-expressing Chlorella vulgaris cells?

To measure and compare sulfate transport activity between wild-type and recombinant CysT-expressing C. vulgaris cells, researchers can implement the following experimental design:

  • Cell preparation:

    • Culture wild-type and CysT-overexpressing C. vulgaris under identical conditions

    • Harvest cells during exponential growth phase

    • Wash cells 3 times with sulfate-free media to remove external sulfate

  • Time-course uptake assays:

    • Resuspend cells to equal density (e.g., 1 × 10^7 cells/mL) in assay buffer

    • Add labeled sulfate (35S-SO4^2-) to a final concentration of 1-100 μM

    • Collect samples at defined time points (15s, 30s, 1min, 2min, 5min, 10min)

    • Filter cells rapidly through glass fiber filters

    • Wash filters with cold buffer to remove unincorporated sulfate

    • Measure radioactivity using liquid scintillation counting

  • Kinetic analysis:

    • Determine initial rates of sulfate uptake at various sulfate concentrations

    • Calculate Km (half-maximal transport rate) and Vmax values

    • Compare kinetic parameters between wild-type and transgenic lines

  • Inhibitor studies:

    • Perform uptake assays in the presence of various inhibitors:

      • Metabolic inhibitors (e.g., CCCP to disrupt proton gradient)

      • Competitive inhibitors (e.g., selenate, chromate)

      • ATP synthesis inhibitors

    • Calculate percent inhibition to determine transport mechanism

  • Environmental factor analysis:

    • Assess sulfate uptake under different conditions:

      • pH range (5.0-9.0)

      • Temperature range (10-40°C)

      • Light vs. dark

      • Various ionic strengths

The resulting data can be analyzed to determine if recombinant CysT expression enhances sulfate transport capacity, alters affinity for sulfate, or changes the response to environmental factors or inhibitors.

How should researchers interpret changes in growth rate and sulfur-containing metabolites in CysT-overexpressing Chlorella vulgaris strains?

When analyzing growth and metabolite data from CysT-overexpressing strains, researchers should consider multiple interpretations:

  • Growth rate analysis:

    • Enhanced growth in sulfur-limited conditions would suggest improved sulfate acquisition

    • Reduced growth despite adequate sulfate might indicate metabolic burden from overexpression

    • Similar growth rates but altered physiological responses to stress might suggest metabolic reallocation

  • Metabolomic interpretation:

    • Increased levels of primary sulfur metabolites (cysteine, methionine) would confirm enhanced sulfur assimilation

    • Elevated glutathione content might indicate improved stress tolerance capacity

    • Changes in sulfur-containing secondary metabolites could suggest metabolic pathway reprogramming

  • Transcriptomic correlations:

    • Downregulation of other sulfate transporters might indicate compensation for CysT overexpression

    • Changes in expression of sulfur assimilation genes would provide insights into metabolic adjustments

    • Altered expression of stress response genes could reveal secondary effects

When interpreting these data, researchers should distinguish between:

  • Direct effects of enhanced sulfate transport

  • Compensatory responses to altered sulfur homeostasis

  • Pleiotropic effects due to the recombinant expression system itself

Control experiments should include both wild-type C. vulgaris and strains expressing a non-functional CysT variant to differentiate between effects caused by the presence of the recombinant protein versus its transport activity.

What are the key considerations when comparing sulfate transport efficiency between different recombinant CysT variants in Chlorella vulgaris?

When comparing different recombinant CysT variants (e.g., wild-type, mutants, or orthologs from other species), several key factors must be considered for accurate interpretation:

  • Expression level normalization:

    • Quantify protein expression levels using Western blot with densitometric analysis

    • Calculate transport rates per unit of expressed protein to account for expression differences

    • Consider using inducible promoters to achieve comparable expression levels

  • Functional parameters to evaluate:

    • Substrate affinity (Km) - lower values indicate higher affinity

    • Maximum transport rate (Vmax) - reflects capacity at saturating substrate concentrations

    • Substrate specificity - test transport of sulfate analogs and other sulfur compounds

    • Energy coupling efficiency - measure ATP consumption relative to transport activity

  • Confounding variables:

    • Protein folding and membrane insertion efficiency may vary between variants

    • Interaction with other components of the transport system might be affected

    • Cellular compensatory mechanisms may differ in response to different variants

  • Data presentation recommendations:

    • Present raw data alongside normalized values

    • Use statistical approaches that account for biological variation

    • Include appropriate controls (non-functional variants, empty vector controls)

The table below provides a framework for comparing key parameters between CysT variants:

ParameterWild-type CysTVariant 1Variant 2Interpretation
Expression levelBaselineX% of WTY% of WTQuantitative difference in protein abundance
Km for sulfateX μMY μMZ μMChanges in substrate affinity
VmaxX nmol/min/mgY nmol/min/mgZ nmol/min/mgChanges in maximal transport capacity
Selectivity ratio (sulfate/selenate)X:1Y:1Z:1Alterations in substrate specificity
Inhibitor sensitivityIC50 = X μMIC50 = Y μMIC50 = Z μMStructural or functional modifications

How can researchers resolve contradictory data regarding the effect of CysT overexpression on sulfur metabolism in Chlorella vulgaris?

When faced with contradictory data regarding CysT overexpression effects, researchers should employ a systematic troubleshooting approach:

  • Experimental validation:

    • Reproduce experiments with increased biological and technical replicates

    • Verify transgene expression at both transcript (RT-qPCR) and protein levels

    • Confirm chloroplast transformation status (homoplasmy vs. heteroplasmy)

    • Test multiple independent transformation lines to rule out position effects

  • Methodological considerations:

    • Evaluate the sensitivity and specificity of assays used

    • Consider the timing of measurements (transient vs. steady-state effects)

    • Assess whether growth conditions were truly identical between experiments

    • Examine the influence of cell density and growth phase on measured parameters

  • Biological complexity analysis:

    • Investigate potential compensatory responses (e.g., downregulation of endogenous transporters)

    • Consider the role of post-translational modifications in regulating CysT activity

    • Evaluate the impact of CysT overexpression on membrane composition and integrity

    • Examine potential bottlenecks in the sulfate assimilation pathway downstream of transport

  • Integration of multiple data types:

    • Combine transcriptomic, proteomic, and metabolomic approaches

    • Use isotope labeling to track sulfur flux through metabolic pathways

    • Develop mathematical models that account for system-level responses

    • Consider time-resolved experiments to capture dynamic responses

  • Contextual factors:

    • Examine the influence of different growth media compositions

    • Test responses under both sulfur-replete and sulfur-limited conditions

    • Evaluate the impact of other environmental stressors (light, temperature, pH)

    • Consider strain-specific differences that might influence outcomes

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more nuanced understanding of how CysT overexpression affects sulfur metabolism in Chlorella vulgaris.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.