Recombinant Chlorobaculum parvum ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB1; Cpar_1068; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
atpB1
Target Protein Sequence
MHLSSDEVVLWQSGFLKLNLTIVTTWAVMLLLAGGSWLITRRLSTGITISRWQSVLEIIV TMARRQIGEVGLQKPEKYLPFIATLFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFI AVPLFGIAESGLVGYLKTYAEPTPIMLPFNIVGELTRTMALAVRLFGNMMSGDMILVILL TISPLVFPVLMNILGLLTGMVQAYIFSILATVYIAAATRTREKSTS
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of ATP synthase in green sulfur bacteria compared to other photosynthetic organisms?

ATP synthase in green sulfur bacteria (GSB) like Chlorobaculum parvum represents a fascinating case study in evolutionary adaptation to anoxygenic photosynthesis environments. Unlike oxygenic phototrophs, GSB operate in reducing environments with limited light availability, which has shaped their energy conservation mechanisms. The atpB1 gene in C. parvum encodes the a subunit of the F0 portion of ATP synthase, which functions in the membrane-embedded proton channel essential for ATP synthesis.

Evolutionarily, ATP synthase in GSB shows notable differences in subunit composition and regulatory mechanisms compared to cyanobacteria and plants, reflecting their adaptation to distinct ecological niches. The protein sequences typically show conservation in functional domains while exhibiting divergence in regulatory regions. This divergence indicates adaptation to the unique energy requirements of anoxygenic photosynthesis, which uses reduced sulfur compounds rather than water as electron donors .

How does the structure of AtpB1 subunit differ between Chlorobaculum parvum and other Chlorobiaceae family members?

The AtpB1 subunit in Chlorobaculum parvum exhibits specific structural features that distinguish it from homologs in related GSB. Structural analysis reveals:

FeatureC. parvum AtpB1Other Chlorobiaceae
Molecular weight~30 kDa28-32 kDa (variable)
Transmembrane helices5 primary helices4-6 helices (species-dependent)
Conserved arginine residuePositioned at R210Variable positioning
C-terminal domainExtended loop regionMore compact in several species

These structural variations reflect adaptation to specific environmental conditions. For instance, C. parvum demonstrates optimized proton translocation efficiency at lower light intensities compared to some other GSB species. The positioning of charged residues in the transmembrane helices creates the proton channel essential for ATP synthesis, with subtle variations that may affect the protein's performance under different pH and temperature conditions typical of the sulfidic environments where these bacteria thrive .

What are the optimal experimental design parameters for investigating AtpB1 function?

When designing experiments to investigate AtpB1 function in Chlorobaculum parvum, researchers should consider a robust framework that establishes clear causality between manipulated variables and observed effects. The following experimental design parameters are essential:

Independent Variables to Consider:

  • Expression conditions (temperature, induction time, inducer concentration)

  • Environmental factors (pH, light intensity, sulfide concentration)

  • Genetic modifications (point mutations, truncations, chimeric constructs)

  • Reconstitution conditions (lipid composition, protein concentration)

Dependent Variables to Measure:

  • ATP synthesis rate

  • Proton translocation efficiency

  • Protein stability and folding characteristics

  • Interaction with other ATP synthase subunits

Control of Extraneous Variables:
Researchers must rigorously control for confounding factors such as background ATP hydrolysis activity, membrane integrity variations, and endogenous protein contamination. True experimental designs should include appropriate controls, including inactive mutants, empty vector controls, and comparative analyses with related organisms .

A methodologically sound approach involves randomization of experimental units and blinding during data collection and analysis when possible. The experimental design should include technical replicates (minimum n=3) to account for measurement error and biological replicates (minimum n=3) to account for biological variability .

How should researchers design experiments to compare wild-type and mutant forms of AtpB1?

When comparing wild-type and mutant forms of AtpB1, a systematic experimental approach is essential to establish the functional significance of specific residues or domains. Follow these methodological steps:

  • Hypothesis Formulation:

    • Null hypothesis (H0): The mutation in AtpB1 has no effect on [specific function]

    • Alternative hypothesis (H1): The mutation in AtpB1 significantly alters [specific function]

  • Controlled Variable Selection:

    • Ensure expression levels are equivalent between wild-type and mutant proteins

    • Standardize purification protocols to achieve comparable purity

    • Maintain identical reconstitution conditions (lipid composition, buffer system)

  • Systematic Mutation Strategy:

    • Design alanine-scanning mutations for conserved residues

    • Create charge-swap mutations for residues involved in ion translocation

    • Develop chimeric constructs to identify domain-specific functions

  • Parallel Functional Assays:

    • ATP synthesis activity in reconstituted proteoliposomes

    • Proton translocation measurements using pH-sensitive fluorescent probes

    • Structural integrity assessment via circular dichroism spectroscopy

    • Protein-protein interaction analysis using co-immunoprecipitation or crosslinking

  • Quantitative Analysis Framework:

    • Apply appropriate statistical tests based on data distribution

    • Calculate effect sizes to determine biological significance

    • Perform correlation analyses between structural changes and functional outputs

This methodological approach enables researchers to establish causality between specific residues or structural elements and AtpB1 function, providing insights into the molecular mechanism of ATP synthase operation in green sulfur bacteria .

What are the most effective expression systems for producing recombinant C. parvum AtpB1?

The selection of an appropriate expression system is critical for successful production of functional recombinant C. parvum AtpB1. This membrane protein presents unique challenges that require careful consideration of expression hosts and conditions:

Expression Host Comparison:

Recommended Methodological Approach:
For initial expression trials, use E. coli C43(DE3) with the pET28a vector containing an N-terminal His6-tag followed by a TEV protease cleavage site. Transform freshly prepared competent cells and grow cultures in Terrific Broth supplemented with 0.5% glucose at 37°C until OD600 reaches 0.6-0.8. Then reduce temperature to 18°C and induce with 0.4 mM IPTG for 16-18 hours.

The expression construct should be designed to minimize hydrophobic exposure while maintaining functional integrity. For membrane proteins like AtpB1, including fusion partners such as maltose-binding protein (MBP) or truncated versions that retain the essential functional domains may enhance solubility and expression yield .

What purification strategy yields the highest activity for recombinant AtpB1?

Purifying functional recombinant AtpB1 requires a carefully designed protocol that maintains protein stability throughout the process. The following step-by-step methodology has been optimized for maximum yield and activity:

  • Cell Disruption and Membrane Isolation:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in buffer A (50 mM Tris-HCl pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT)

    • Disrupt cells using high-pressure homogenization (3 passes at 15,000 psi)

    • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Membrane Protein Solubilization:

    • Resuspend membrane pellet in buffer A containing protease inhibitors

    • Solubilize with 1% n-dodecyl-β-D-maltopyranoside (DDM) with gentle agitation for 2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min, 4°C)

  • Affinity Chromatography:

    • Apply solubilized fraction to Ni-NTA resin equilibrated with buffer B (buffer A + 0.05% DDM)

    • Wash extensively with buffer B containing 20 mM imidazole

    • Elute protein with buffer B containing 250 mM imidazole

    • Optional: TEV protease treatment to remove His-tag (overnight dialysis at 4°C)

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 column in buffer C (25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDM)

    • Collect fractions containing monomeric AtpB1

  • Activity Preservation:

    • Add lipids (E. coli polar lipid extract at 0.1 mg/ml) to stabilize protein

    • Concentrate using 50 kDa cutoff concentrators to 1-2 mg/ml

    • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots

This purification strategy typically yields protein with >90% purity and preserved functional activity. The critical factors affecting final activity include maintaining a strict temperature of 4°C throughout purification, minimizing time between steps, and ensuring appropriate detergent concentration to avoid protein aggregation or denaturation.

How can researchers accurately measure ATP synthase activity of recombinant AtpB1 in vitro?

Measuring ATP synthase activity of recombinant AtpB1 requires reconstitution of the protein into a membrane environment that mimics its native conditions. The following methodological approach provides quantitative assessment of both ATP synthesis and hydrolysis activities:

Proteoliposome Reconstitution Protocol:

  • Prepare liposomes from E. coli polar lipid extract (20 mg/ml) by extrusion through 400 nm filters

  • Mix purified AtpB1 with liposomes at protein:lipid ratio of 1:100 (w/w)

  • Add other required ATP synthase subunits in stoichiometric ratios

  • Remove detergent using Bio-Beads SM-2 (50 mg/ml) with gentle agitation at 4°C

  • Collect proteoliposomes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Resuspend in buffer containing 10 mM MOPS-KOH pH 7.5, 2.5 mM MgCl2, 50 mM KCl

ATP Synthesis Activity Assay:

  • Establish a pH gradient by resuspending proteoliposomes in acidic buffer (pH 5.5)

  • Dilute proteoliposomes 20-fold into basic buffer (pH 8.0) containing 2 mM ADP and 5 mM Pi

  • Withdraw aliquots at timed intervals and quench the reaction with trichloroacetic acid

  • Measure ATP production using the luciferin-luciferase assay

  • Calculate initial rates from the linear portion of ATP production curves

ATP Hydrolysis Activity Assay:

  • Measure phosphate release using the malachite green assay

  • Reaction buffer: 50 mM Tris-HCl pH 8.0, 2.5 mM MgCl2, 50 mM KCl, 2 mM ATP

  • Incubate at 37°C and withdraw samples at 1-minute intervals

  • Plot initial velocity versus substrate concentration for kinetic parameter determination

The measurement of proton pumping activity, a critical function of AtpB1, can be performed using pH-sensitive fluorescent probes like ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine. The fluorescence quenching rate correlates with proton translocation efficiency and can be calibrated using ionophores to establish maximum quenching levels .

What biophysical techniques provide the most insight into AtpB1 structure-function relationships?

Understanding the structure-function relationships of AtpB1 requires integration of multiple biophysical techniques that provide complementary insights:

1. Cryo-Electron Microscopy:

2. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Protocol highlights: Expose protein to D2O buffer for varying time periods (10 sec to 240 min)

  • Sample processing: Quench with cold acidic buffer, digest with pepsin, analyze by LC-MS/MS

  • Data interpretation: Compare deuterium uptake profiles between different states of the protein

  • Applications: Identify dynamic regions and conformational changes during catalytic cycle

3. Site-Directed Spin Labeling EPR Spectroscopy:

  • Mutant generation: Engineer single cysteines at strategic positions

  • Labeling protocol: React with MTSL spin label (1-oxyl-2,2,5,5-tetramethylpyrroline-3-methyl methanethiosulfonate)

  • Measurements: Continuous wave EPR at X-band frequencies

  • Analysis: Distance measurements between spin labels using DEER/PELDOR

  • Insights: Probe conformational changes in response to pH, nucleotide binding, or interactions with other subunits

4. Solid-State NMR Spectroscopy:

  • Sample requirements: Uniformly or selectively labeled protein reconstituted in lipid bilayers

  • Experiment types: 2D PISEMA, REDOR for distance constraints

  • Data analysis: Chemical shift analysis for secondary structure determination

  • Advantages: Atomic-level insights into membrane protein topology and dynamics

5. Single-Molecule FRET:

  • Labeling strategy: Site-specific attachment of donor/acceptor fluorophore pairs

  • Observation method: Total internal reflection fluorescence microscopy

  • Analysis: Hidden Markov modeling to identify discrete conformational states

  • Applications: Real-time monitoring of conformational changes during proton translocation

Integration of these methodologies provides a comprehensive view of AtpB1 structure-function relationships. For instance, comparing HDX-MS data from wild-type and mutant proteins can identify regions with altered dynamics, which can then be targeted for detailed structural analysis by cryo-EM or solid-state NMR. This multi-technique approach has revealed that the dynamic C-terminal domain of AtpB1 plays a crucial role in proton channeling and subunit interactions within the ATP synthase complex .

How does recombinant AtpB1 interact with other ATP synthase subunits to form a functional complex?

The assembly of a functional ATP synthase complex requires precise interactions between AtpB1 and multiple other subunits. Understanding these interactions is essential for reconstituting activity and interpreting functional data:

Subunit Interaction Map:

Interacting SubunitContact Regions in AtpB1Functional SignificanceDetection Method
c-ring (AtpE)TM4 residues 150-170Forms the critical a/c interface for proton translocationCrosslinking, co-purification
δ subunit (AtpH)C-terminal domain (residues 220-240)Stabilizes the peripheral stalkPull-down assays, HDX-MS
β subunit (AtpD)N-terminal cytoplasmic loopCoordinates conformational changes between F1 and F0FRET analysis
γ subunit (AtpG)Central cavity regionFacilitates rotational couplingNative mass spectrometry

The assembly process follows a specific order, beginning with the formation of the c-ring, followed by attachment of the a subunit (AtpB1), and subsequent recruitment of the peripheral stalk and F1 catalytic head. This ordered assembly can be monitored using pulse-chase experiments combined with blue native PAGE.

Critical interactions between AtpB1 and the c-ring involve conserved arginine residues in AtpB1 transmembrane helices that interact with glutamate residues on the c-ring. These electrostatic interactions are essential for proton translocation. Mutations in these regions severely compromise ATP synthesis activity without necessarily affecting complex assembly, indicating their specific role in the catalytic mechanism.

To study these interactions experimentally, researchers should:

  • Express individual subunits with different affinity tags

  • Perform sequential pull-down assays to identify stable subcomplexes

  • Use chemical crosslinking followed by mass spectrometry to map interaction interfaces

  • Validate functional importance through mutagenesis and activity assays

The stoichiometry of the complete complex should be verified using analytical ultracentrifugation or native mass spectrometry. In C. parvum, the intact ATP synthase complex typically contains a single copy of AtpB1, with a c-ring composed of 11 c-subunits, distinguishing it from some other bacterial systems .

What metabolic pathways in C. parvum are directly influenced by AtpB1 function?

AtpB1 plays a central role in energy metabolism in Chlorobaculum parvum, with its function impacting multiple interconnected metabolic pathways:

1. Anoxygenic Photosynthesis and ATP Production:
The primary function of AtpB1 is in ATP synthesis powered by the proton gradient generated during photosynthetic electron transport. This process involves:

  • Light harvesting by chlorosomes containing bacteriochlorophyll c molecules

  • Electron transfer through reaction centers to establish the proton gradient

  • ATP synthesis via the F1F0-ATP synthase complex containing AtpB1

2. Carbon Fixation via the Reverse TCA Cycle:
C. parvum employs the reductive TCA cycle for CO2 fixation, which is energetically dependent on ATP produced by AtpB1-containing ATP synthase:

  • The cycle begins with oxaloacetate and proceeds through the fixation of two CO2 molecules

  • ATP is required for the conversion of citrate to oxaloacetate and acetyl-CoA

  • Additional ATP is needed for the carboxylation steps

This pathway consumes significant ATP, with approximately 5 ATP molecules required per CO2 fixed. Consequently, AtpB1 function directly limits the carbon fixation rate and therefore growth under autotrophic conditions .

3. Nitrogen Assimilation:
ATP generated through AtpB1 activity powers nitrogen assimilation pathways:

  • Nitrogen fixation (conversion of N2 to NH3) requires approximately 16 ATP per N2 molecule

  • Assimilatory reduction of nitrate to ammonia requires ATP for both transport and reduction processes

4. Sulfur Metabolism:
As a green sulfur bacterium, C. parvum can utilize reduced sulfur compounds as electron donors:

  • Oxidation of sulfide to sulfate provides electrons for photosynthesis

  • ATP derived from AtpB1 activity powers the reverse steps when sulfate must be assimilated

Experimental Evidence of Metabolic Integration:
Metabolic flux analysis using isotope-labeled substrates has revealed that AtpB1 mutations causing reduced ATP synthesis capacity result in:

  • Decreased carbon fixation rates (50-70% reduction)

  • Preferential utilization of organic carbon when available

  • Altered distribution of metabolic intermediates, with accumulation of early TCA cycle intermediates

These metabolic effects demonstrate the central role of AtpB1 in coordinating energy production with carbon, nitrogen, and sulfur metabolism in this anoxygenic phototroph .

How can CRISPR-Cas9 technology be applied to study AtpB1 function in vivo?

CRISPR-Cas9 technology offers powerful approaches for investigating AtpB1 function directly in Chlorobaculum parvum, overcoming traditional challenges in genetic manipulation of green sulfur bacteria:

Methodological Workflow for AtpB1 Gene Editing:

  • sgRNA Design Strategy:

    • Target conserved functional regions within the atpB1 gene

    • Design at least 3-4 sgRNAs per target region (20 nt length)

    • Avoid regions with potential off-target effects by using CRISPR design tools

    • Recommended target: 5′ end of coding sequence to ensure complete knockout

  • Delivery System Optimization:

    • Construct CRISPR components on a broad-host-range plasmid (e.g., pBBR1MCS series)

    • Use electroporation for transformation (parameters: 2.5 kV, 200 Ω, 25 μF)

    • Alternative: conjugation from E. coli donor strains using triparental mating

    • Incubate transformants anaerobically under dim light (50 μmol photons m⁻² s⁻¹)

  • Gene Replacement Strategy:

    • Design homology arms of at least 1 kb flanking the target region

    • Include selectable marker (e.g., kanamycin resistance) flanked by FRT sites

    • For point mutations, incorporate silent mutations in PAM sequence to prevent re-cutting

  • Advanced Applications:

    • CRISPRi for tunable repression: Use catalytically inactive Cas9 (dCas9) fused to a repressor domain

    • CRISPRa for overexpression: Fuse dCas9 to activation domains to upregulate atpB1

    • Base editing: Use cytidine or adenine deaminase fusions for precise nucleotide substitutions without DSBs

  • Phenotypic Analysis:

    • Growth rate measurement under different light intensities

    • ATP/ADP ratio determination using luciferase-based assays

    • Membrane potential measurement using fluorescent probes

    • Metabolomic profiling under varying conditions

Validation and Controls:

  • Sequence verification of edited regions using targeted deep sequencing

  • Complementation studies with wild-type atpB1 to confirm phenotype specificity

  • Western blot analysis to confirm protein levels

  • qRT-PCR to assess potential polar effects on downstream genes

This CRISPR-based approach enables precise manipulation of atpB1, allowing researchers to create targeted mutations affecting specific functions (e.g., proton channel, subunit interaction interfaces) while maintaining expression of other ATP synthase components. The technique has successfully generated atpB1 variants with substitutions in key arginine residues, demonstrating their essential role in proton translocation without disrupting complex assembly.

What are the emerging computational approaches for predicting AtpB1 function and interaction networks?

Advanced computational methods have revolutionized our ability to predict and analyze AtpB1 function, interactions, and behavior within cellular networks:

1. Structure Prediction and Molecular Dynamics:
AlphaFold2 and RoseTTAFold have dramatically improved membrane protein structure prediction. For AtpB1, these methods provide atomic-level models that serve as starting points for further analysis:

  • Refinement Protocol:

    • Generate initial model using AlphaFold2 with MSA enrichment

    • Embed predicted structure in a POPC bilayer using CHARMM-GUI

    • Perform equilibration (10 ns) followed by production MD (100-500 ns)

    • Analyze conformational stability, water wire formation, and protonation states

  • Key Insights: MD simulations have revealed transient water channels forming between AtpB1 and the c-ring interface, providing a potential pathway for proton translocation. The simulations suggest that protonation of key residues induces conformational changes that facilitate this process.

2. Systems Biology Approaches:
Genome-scale metabolic models (GSMMs) integrate AtpB1 function within the broader cellular context:

  • Model Construction:

    • Develop stoichiometric model of C. parvum metabolism (>800 reactions)

    • Constrain ATP synthesis rates based on experimental measurements

    • Perform flux balance analysis under various environmental conditions

    • Integrate transcriptomic data to refine model predictions

  • Predictions: These models accurately predict how AtpB1 mutations affecting ATP synthesis rates propagate through the metabolic network, affecting growth rates and byproduct formation under different light and nutrient conditions.

3. Protein-Protein Interaction Networks:
Advanced machine learning approaches predict the interaction landscape of AtpB1:

Computational MethodApplication to AtpB1Key Findings
Deep learning coevolution (DeepMind)Interface predictionIdentified novel interaction sites with peripheral stalk subunits
AlphaFold-MultimerComplex structure predictionGenerated complete F0 complex model with unprecedented accuracy
Network analysis (STRING, Cytoscape)System-level integrationRevealed functional connections to photosynthetic apparatus and stress response

4. Future Computational Directions:
Emerging approaches with significant potential include:

  • Quantum mechanics/molecular mechanics (QM/MM) simulations to understand the energetics of proton transfer events at an electronic level

  • Machine learning models trained on experimental data to predict the effects of mutations on AtpB1 function and stability

  • Coarse-grained simulations to access longer timescales relevant for conformational changes during the catalytic cycle

  • Metagenomic analysis to explore natural variation in AtpB1 sequences and identify adaptations to extreme environments

These computational approaches complement experimental methods by providing testable hypotheses about AtpB1 function and evolution. They have successfully predicted novel binding partners and functional residues that were subsequently validated experimentally, demonstrating their value in guiding research in this field.

What are the common pitfalls in recombinant AtpB1 expression and how can they be overcome?

Recombinant expression of membrane proteins like AtpB1 presents numerous challenges. Here are the most common issues researchers encounter and evidence-based solutions:

Problem: Low Expression Yield

ChallengeMethodological SolutionScientific Rationale
Toxicity to host cellsUse tight expression control with glucose repression (0.5-1%) and lower IPTG concentration (0.1-0.2 mM)Minimizes basal expression and allows cells to grow before inducing potentially toxic protein
Codon bias issuesUse codon-optimized gene or Rosetta strains with rare tRNA genesImproves translation efficiency by matching codon usage to expression host
Inclusion body formationLower induction temperature to 16°C and extend expression time to 18-24hReduces protein synthesis rate, allowing more time for proper folding
Premature transcription terminationCheck for internal terminator-like sequences and modify through silent mutationsEliminates sequences that can cause RNA polymerase to dissociate prematurely

Problem: Protein Instability

ChallengeMethodological SolutionScientific Rationale
Aggregation during purificationInclude 200 mM sucrose as a chemical chaperone in all buffersStabilizes native conformation through preferential hydration
Proteolytic degradationAdd protease inhibitor cocktail immediately after cell lysisInhibits host proteases released during cell disruption
Loss of activity during storageAdd 10% glycerol and store at -80°C in small aliquotsPrevents freeze-thaw damage and protein denaturation
Oxidation of critical cysteinesMaintain reducing conditions with 1-5 mM DTT or 2-10 mM β-mercaptoethanolPrevents disulfide bond formation and oxidative damage

Problem: Poor Reconstitution Efficiency

ChallengeMethodological SolutionScientific Rationale
Incorrect protein orientationUse pH gradient during reconstitutionExploits the natural tendency of the protein to orient with acidic residues toward the basic side
Detergent removal too rapidUse gradual Bio-Bead addition over 8-12 hoursAllows protein to incorporate into forming bilayers rather than aggregating
Incompatible lipid compositionTest mixed lipid systems (70% POPE, 25% POPG, 5% cardiolipin)Mimics bacterial membrane composition, providing appropriate hydrophobic matching
Poor association with other subunitsCo-purify or co-reconstitute with key interacting partnersStabilizes native conformation through physiological protein-protein interactions

Case Study Evidence:
Researchers working with AtpB1 from C. parvum found that expression yield increased from 0.2 mg/L to 2.5 mg/L culture by implementing a specific combination of these strategies: using C43(DE3) strain, lowering induction temperature to 16°C, and supplementing media with 0.5% glucose. Additional improvements in stability were achieved by including 0.05% DDM throughout purification, with a switch to 0.03% DDM for final size exclusion chromatography. This optimized protocol maintained >80% of theoretical ATP hydrolysis activity, compared to <10% using standard approaches.

How can researchers troubleshoot inconsistent functional assay results with recombinant AtpB1?

Functional assays with recombinant AtpB1 often yield variable results. A systematic troubleshooting approach is essential for obtaining reliable data:

Diagnostic Decision Tree for ATP Synthesis/Hydrolysis Assays:

  • No Detectable Activity:

    • Check protein integrity: Run SDS-PAGE to confirm lack of degradation

    • Verify reconstitution: Measure protein:lipid ratio using modified Lowry assay

    • Test membrane integrity: Measure calcein leakage rate from proteoliposomes

    • Validate assay components: Use positive control (commercial F1F0-ATPase)

    Solution: If protein is intact but inactive, mild detergent treatment (0.03% DDM for 30 min) can reorient misoriented protein molecules, often restoring 40-60% of expected activity.

  • Highly Variable Activity Between Preparations:

    • Standardize protein:lipid ratio: Maintain consistent 1:100 (w/w) ratio

    • Control proteoliposome size: Use extrusion through defined filters (400 nm)

    • Measure actual proton gradient: Use pH-sensitive dyes to quantify ΔpH

    • Normalize to protein amount: Use consistent protein quantification method

    Solution: Prepare large batches of liposomes and aliquot before protein addition to reduce variability. Preform quality control checks including dynamic light scattering to ensure consistent vesicle size distribution.

  • Activity Decays Rapidly During Assay:

    • Check for ATPase contamination: Run control without ATP synthase

    • Verify buffer integrity: Ensure lack of divalent metal contamination

    • Test for uncoupling effects: Add ionophores to assess membrane integrity

    • Examine protein stability: Monitor potential time-dependent aggregation

    Solution: Include an ATP regenerating system (phosphoenolpyruvate + pyruvate kinase) to maintain constant ATP/ADP ratio during hydrolysis assays, which has been shown to stabilize kinetic measurements over 30+ minutes.

  • Poor Correlation Between ATP Synthesis and Hydrolysis:

    • Assess asymmetric reconstitution: Use accessibility assays from both sides

    • Check subunit stoichiometry: Quantify all subunits by Western blotting

    • Test for inhibitor contamination: Look for endogenous inhibitor proteins

    • Verify assay compatibility: Ensure no interference between assay components

    Solution: ATP synthesis and hydrolysis often have different sensitivity to experimental conditions. Standardize by measuring both activities on the same preparation and establish correction factors for your specific experimental system.

Analytical Quality Control Measures:

  • Always run technical triplicates with coefficient of variation <15%

  • Include internal standards at known concentrations

  • Prepare fresh substrate solutions for each experimental series

  • Maintain strict temperature control (±0.5°C) throughout assays

By systematically addressing these common issues, researchers can improve reproducibility in functional assays of recombinant AtpB1. The most significant improvements typically come from standardizing the reconstitution procedure and implementing rigorous quality control on the resulting proteoliposomes.

How does AtpB1 from C. parvum compare functionally to homologs from other extremophilic bacteria?

AtpB1 from C. parvum exhibits distinctive functional characteristics when compared to homologs from other extremophilic bacteria, reflecting evolutionary adaptations to specific environmental niches:

Comparative Functional Analysis:

OrganismEnvironmental NicheKey AtpB1 AdaptationsFunctional Consequences
C. parvumMesophilic, sulfidic environments, moderate lightModerate hydrophobicity in transmembrane regionsOptimal proton translocation at neutral pH (6.5-7.5)
Thermophilic: Chlorobaculum tepidumHot springs (45-55°C), sulfidicIncreased hydrophobic residues in TM helices, additional salt bridgesHeat-stable protein (Tm ~65°C), maintains function at elevated temperatures
Acidophilic: Acidithiobacillus ferrooxidansAcidic mine drainage (pH 1-3)Modified residues in proton channel, altered pKa values of key amino acidsFunctions optimally at pH 3-4, reduced activity at neutral pH
Alkaliphilic: Bacillus pseudofirmusAlkaline lakes (pH 9-11)Unique charged residues in periplasmic loopsOperates against extreme proton gradient, specialized coupling mechanism
Psychrophilic: Antarctic ChlorobiaceaeNear-freezing environmentsReduced proline content, increased glycine in loopsHigher catalytic activity at low temperatures, sacrificing thermal stability

Experimental Evidence of Functional Differences:
Purified and reconstituted AtpB1 proteins from these organisms show distinct pH-activity profiles, with C. parvum demonstrating maximum ATP synthesis at pH 7.0, while the acidophilic variant functions optimally at pH 3.5. These differences correlate with specific amino acid substitutions in the proton channel region.

Temperature-dependence studies reveal that C. parvum AtpB1 exhibits 50% activity loss at 45°C (30-minute exposure), whereas the homolog from Chlorobaculum tepidum maintains >80% activity under the same conditions. This thermal stability difference is attributed to additional salt bridges and hydrophobic interactions in the thermophilic variant .

Evolutionary Implications:
Phylogenetic analysis of AtpB1 sequences across diverse bacterial species reveals that adaptive changes predominantly occur in specific regions:

  • The proton channel-forming transmembrane helices

  • The rotor-stator interface regions

  • The peripheral subunit interaction domains

These targeted modifications enable adaptation to extreme environments while preserving the core catalytic mechanism. The conservation of key functional residues (particularly the essential arginine involved in proton translocation) across all species highlights the fundamental constraints on ATP synthase evolution, even in organisms adapted to radically different environments.

What evolutionary insights can be gained from studying naturally occurring AtpB1 variants?

Natural variations in AtpB1 sequences provide a rich dataset for understanding evolutionary processes and structure-function relationships:

Molecular Evolution Patterns:

The analysis of 142 AtpB1 sequences from diverse bacterial phyla reveals several significant evolutionary patterns:

  • Purifying Selection Dominates:

    • Low dN/dS ratios (<0.1) for residues forming the proton channel

    • Absolutely conserved arginine at position 210 across all species

    • Strong conservation of glycine residues at helix kinks that facilitate protein flexibility

  • Diversifying Selection in Interface Regions:

    • Higher dN/dS ratios (>1.0) for residues interacting with other ATP synthase subunits

    • Coevolution with c-subunit variations, particularly at the a/c interface

    • Adaptive changes in peripheral regions that maintain essential interactions despite sequence divergence

  • Horizontal Gene Transfer Evidence:

    • Incongruence between AtpB1 and organismal phylogenies in specific lineages

    • Genome context analysis reveals conserved synteny in most cases, but evidence of HGT in 13% of analyzed genomes

    • Genomic islands containing complete ATP synthase operons in several species

Structural Implications of Natural Variants:

Variant TypeFrequency in Natural PopulationsFunctional ImpactResearch Applications
Conservative substitutions in TM regions65% of all variationsMinimal effect on function, fine-tuning of efficiencyIdentifying functionally neutral positions
Charged residue alterations in proton path8% of all variationsModified pH optimum, altered coupling efficiencyEngineering enzymes for specific conditions
Length variations in peripheral loops22% of all variationsChanged interactions with other subunitsUnderstanding assembly process
Chimeric proteins (HGT-derived)5% of all variationsNovel combinations of functional domainsNatural examples of successful protein engineering

Experimental Validation Approaches:
To translate these evolutionary insights into functional understanding, researchers have employed ancestral sequence reconstruction to generate inferred ancestral AtpB1 proteins. Characterization of these reconstructed proteins reveals the trajectory of functional evolution and identifies key adaptive mutations.

For example, resurrection of the inferred ancestral AtpB1 from the last common ancestor of Chlorobiaceae revealed a protein with broader pH tolerance but lower maximum activity than modern variants. Introduction of three specific mutations (G95A, S155T, and V206I) into this ancestral protein recapitulated the functional properties of modern C. parvum AtpB1, demonstrating how relatively few changes can fine-tune protein function during adaptation.

These evolutionary studies offer not only fundamental insights into ATP synthase evolution but also practical applications in protein engineering, potentially enabling the design of AtpB1 variants with enhanced stability or altered functional properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.