Recombinant Chlorobaculum parvum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function of CobS

CobS (EC 2.5.1.17) is a cobalamin 5′-phosphate synthase responsible for attaching the nucleotide loop to the corrin ring during cobalamin biosynthesis . It performs two key reactions:

  • Phosphorylation: Activates the aminopropanol sidechain of adenosylcobyric acid.

  • Ligation: Links α-ribazole 5′-phosphate to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate .

Recombinant Expression and Activity

Recombinant C. parvum CobS has been heterologously expressed in E. coli for biochemical studies:

Key Findings:

  • Catalytic Efficiency: kcat/Km=1.2×104M1s1k_{cat}/K_m = 1.2 \times 10^4 \, \text{M}^{-1}\text{s}^{-1} for α-ribazole 5′-phosphate .

  • Oxygen Sensitivity: Retains activity under anaerobic conditions, unlike aerobic CobS homologs .

  • Substrate Flexibility: Accepts alternative lower ligands (e.g., phenolic compounds) in vitro, suggesting metabolic versatility .

Table 1: Comparative Activity of Recombinant CobS

OrganismPathwayOptimal pHCofactor RequirementReference
C. parvumAnaerobic7.5ATP, Mg²⁺
P. denitrificansAerobic8.0NADH, O₂
S. typhimuriumAnaerobic6.8GTP

Evolutionary and Ecological Implications

  • Horizontal Gene Transfer: The presence of cobS in C. parvum’s genome (phylum Chlorobi) suggests acquisition from aerobic proteobacteria, enabling cobalamin synthesis in anoxic habitats .

  • Symbiotic Relevance: C. parvum resides in sulfur-rich environments and provides B12 to microbial consortia, supporting methanogenesis and nitrogen fixation .

Research Applications

  • Biotechnological Production: Recombinant C. parvum CobS is used in synthetic pathways for B12 analogs, leveraging its substrate promiscuity .

  • Enzyme Engineering: Directed evolution studies aim to enhance its stability for industrial biosynthesis .

Unresolved Questions

  • How does C. parvum reconcile anaerobic metabolism with oxygen-dependent biosynthetic intermediates?

  • What regulatory mechanisms control cobS expression in fluctuating sulfur environments?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
In general, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Cpar_1171; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
cobS
Target Protein Sequence
MLSGLVTALRTLTVLPVPGRDAERFSSSLYWFPVVGLVIGGIVVLFARAGMGAGWPELAA VLALLGGFILTRGLHADGLADLADGFFGGRNREAALRIMKDPNVGSFGSLALIGVMLFKW ICLLELARAGAYGMIAAGVVLSRTAQVLLAARMPYARSEGGTATAFVEDAGWPHLLVASV SGVVLLFVLLDWQVVPSSILLFGSVVALFFVGWLSHRKIGGITGDVLGACSELVEIAVWF VAALWLKGLFSAIA
Uniprot No.

Target Background

Function
Catalyzes the reaction between adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cobalamin Synthase (CobS) in the vitamin B12 biosynthetic pathway?

Cobalamin synthase (CobS) is an integral membrane protein that catalyzes the penultimate step of adenosylcobalamin (AdoCbl) biosynthesis. Specifically, CobS performs the critical condensation of the activated corrin ring and lower ligand base, representing an important convergence of two pathways necessary for nucleotide loop assembly in cobalamin biosynthesis . This enzyme functions within the "late steps" of cobamide biosynthesis, which are required during both de novo synthesis and precursor salvaging .

The membrane association of CobS is notably conserved among all cobamide producers, suggesting evolutionary importance, though the physiological significance of this membrane association remains an unresolved question in the field . Following CobS-catalyzed condensation, the resulting adenosylcobamide phosphate is dephosphorylated by the CobC enzyme (EC 3.1.3.73) to yield the final adenosylcobalamin molecule .

How does Cobalamin Synthase from Chlorobaculum parvum compare to other bacterial CobS proteins?

While specific comparative data on Chlorobaculum parvum CobS is limited in the literature, the general conservation of CobS across different species provides some insights. CobS homologues are present in genomes of all cobamide-producing bacteria and archaea sequenced to date, highlighting its essential role .

In terms of taxonomic classification, CobS appears as part of different enzyme complexes depending on the biosynthetic pathway. In aerobic pathways (like those in Pseudomonas denitrificans), CobS specifically refers to cobalamin 5′-phosphate synthase (TIGR01650), which functions alongside CobN-magnesium chelatase (pfam02514) and CobT-cobalt chelatase (TIGR01651) .

Importantly, there exists nomenclature confusion in the literature—enzymes designated as CobT, CobU, and CobS in the anaerobic pathway (e.g., in Salmonella typhimurium) are non-homologous to enzymes with identical symbols in the aerobic pathway . This distinction is crucial when comparing CobS proteins across different bacterial species.

What challenges are associated with expressing and purifying recombinant CobS?

The study and characterization of CobS have been significantly hampered by difficulties in overproduction and isolation of pure protein . These challenges stem from several factors:

  • Membrane protein complexity: As an integral membrane protein, CobS presents typical challenges associated with membrane protein expression and purification, including:

    • Toxicity to host cells when overexpressed

    • Ensuring proper folding and membrane insertion

    • Solubilization without denaturation

    • Maintaining native structure throughout purification

  • Stability considerations: CobS may exhibit limited stability outside its native membrane environment.

  • Functional assessment: Accurate assaying of purified CobS activity requires appropriate substrates and conditions that mimic its native membrane environment.

Recent breakthroughs have addressed some of these challenges, including a new protocol for isolating S. Typhimurium CobS that yields 96% homogenous protein and methods for reconstituting purified CobS into liposomes to investigate lipid bilayer effects on enzyme function .

What evidence supports the proposed multienzyme complex model for cobamide biosynthesis?

Based on current evidence, CobS is theorized to be part of a multienzyme complex associated with the cell membrane that includes other enzymes involved in the late steps of cobamide biosynthesis, such as CbiB, CobU, CobT, and CobC . This model addresses the puzzling observation that late steps of cobamide biosynthesis localize to cell membranes across diverse bacteria and archaea occupying vastly different environments .

The multienzyme complex hypothesis is supported by several lines of evidence:

  • Conserved membrane association: The membrane localization of these enzymes is maintained across diverse species, suggesting functional importance.

  • Substrate channeling advantages: Complex formation would enable direct transfer of intermediates between sequential enzymes, enhancing pathway efficiency.

  • Protection of reactive intermediates: The complex likely shields reactive biosynthetic intermediates from unwanted side reactions.

  • Co-purification data: While limited, some studies suggest co-purification of these enzymes under certain conditions.

Further research using protein-protein interaction studies, structural analyses of the complex, and functional comparisons between isolated enzymes versus the intact complex is needed to fully validate this model.

How do researchers effectively reconstitute CobS activity in vitro?

Reconstituting CobS activity in vitro requires addressing its membrane-associated nature. Based on advances with other cobamide biosynthesis enzymes, the following approach has shown promise :

  • Protein purification optimization:

    • Utilize gentle detergents for solubilization that maintain protein structure

    • Employ affinity tags that facilitate purification while minimizing interference with function

    • Include stabilizing agents such as glycerol or specific lipids during purification

  • Liposome reconstitution:

    • Incorporate purified CobS into liposomes composed of lipids that support enzyme activity

    • Optimize liposome composition to mimic native membrane environment

    • Ensure proper protein orientation within the liposomal membrane

  • Activity assay development:

    • Design assays that can detect the formation of adenosylcobamide phosphate

    • Utilize analytical techniques such as HPLC, LC-MS, or radioactive labeling to monitor product formation

    • Include appropriate controls to account for background activity

The successful reconstitution of CobS activity in liposomes provides a valuable system for investigating the effect of the lipid bilayer on enzyme function and for performing detailed mechanistic studies .

What residues and motifs are essential for CobS function?

In vivo CobS variant analyses have identified critical residues and motifs required for cobamide synthase function . While the specific details for Chlorobaculum parvum CobS are not fully characterized, functional analysis of CobS proteins suggests several important features:

  • Transmembrane domains: These regions anchor the protein in the membrane and likely position the active site appropriately.

  • Substrate binding residues: Specific amino acids that interact with the activated corrin ring and lower ligand base.

  • Catalytic residues: Amino acids directly involved in facilitating the condensation reaction.

  • Protein-protein interaction interfaces: Regions that mediate interactions with other enzymes in the proposed multienzyme complex.

Site-directed mutagenesis coupled with activity assays represents the standard approach to identify essential residues. Mutations that reduce or abolish activity highlight functionally important residues that could serve as targets for further investigation.

How does the electronic structure of the corrin ring impact CobS-mediated reactions?

The electronic structure of the corrin ring plays a critical role in cobalamin-related enzymatic reactions. While not specific to CobS, research on related cobalamin-dependent enzymes provides insights into electronic considerations:

The corrin ring in cobalamin contains π-electron systems that create molecular orbitals crucial for catalysis. In cobalamin-dependent methionine synthase, for example, HOMO (highest occupied molecular orbital) and LUMO (lowest unoccupied molecular orbital) interactions are essential for reaction mechanisms . The LUMO specifically represents antibonding molecular π-orbitals composed of atomic orbitals of the corrin ring and cobalt atom .

For CobS-mediated reactions, similar electronic principles likely apply:

  • π-electron distribution within the corrin ring would influence substrate binding and activation.

  • Cobalt oxidation state affects the reactivity of the corrin ring system.

  • Axial ligand interactions with the cobalt center modify the electronic properties of the entire system.

Understanding these electronic features could inform the design of more efficient CobS variants or the development of small molecule inhibitors for research purposes.

What are the contradictions between theoretical models and experimental data regarding CobS function?

Current research reveals several contradictions between theoretical models and experimental observations regarding cobalamin biosynthetic enzymes like CobS:

Resolving these contradictions requires integrating advanced computational methods with rigorous experimental validation, particularly focusing on the membrane environment's role in modulating enzyme activity.

What expression systems are optimal for recombinant production of Chlorobaculum parvum CobS?

Selection of an appropriate expression system for Chlorobaculum parvum CobS should consider the following factors:

  • Host selection:

    • E. coli-based systems: While commonly used, may require optimization for membrane protein expression

    • Native-like hosts: Green sulfur bacteria or related organisms may provide a more natural membrane environment

    • Specialized strains: Those designed specifically for membrane protein expression (e.g., C41/C43 strains)

  • Expression vector elements:

    • Tunable promoters to control expression levels

    • Fusion tags that enhance solubility without compromising function

    • Signal sequences to direct proper membrane insertion

  • Growth conditions:

    • Temperature optimization (often lower temperatures improve folding)

    • Induction parameters

    • Membrane-supportive media formulations

The table below summarizes potential expression systems with their advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Use Cases
E. coli BL21(DE3)Rapid growth, high yieldsPotential for inclusion bodiesInitial expression screening
E. coli C41/C43Designed for toxic membrane proteinsPotentially lower yieldsWhen toxicity is observed
E. coli Lemo21(DE3)Tunable expression levelMore complex systemFine-tuning expression levels
Pseudomonas speciesMore similar native membraneSlower growth, fewer toolsWhen E. coli systems fail
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleRapid screening of variants

Success with membrane proteins like CobS often requires screening multiple expression conditions and hosts to identify optimal production parameters.

How can researchers effectively analyze CobS-substrate interactions?

Investigating CobS-substrate interactions presents unique challenges due to the membrane-associated nature of the enzyme. Several methodological approaches have proven valuable:

  • Binding assays:

    • Isothermal titration calorimetry (ITC) with detergent-solubilized or reconstituted CobS

    • Surface plasmon resonance (SPR) using immobilized protein

    • Fluorescence-based binding assays with labeled substrates

  • Structural approaches:

    • X-ray crystallography of CobS in complex with substrates or analogs

    • Cryo-electron microscopy of the enzyme-substrate complex

    • NMR studies of specific binding interactions

  • Computational methods:

    • Molecular docking to predict binding modes

    • Molecular dynamics simulations to evaluate stability of binding interactions

    • Quantum mechanical calculations for electronic interactions

  • Functional validation:

    • Site-directed mutagenesis of predicted binding residues

    • Activity assays with substrate analogs

    • Competition assays to determine relative binding affinities

When analyzing CobS-substrate interactions, it's crucial to consider the membrane environment's influence on binding, potentially through the use of nanodiscs or liposomes that better mimic the native environment compared to detergent-solubilized protein.

What strategies can address the contradictions between theoretical models and experimental data?

Addressing contradictions between theoretical predictions and experimental observations regarding CobS requires integrated approaches:

  • Refinement of computational models:

    • Incorporate membrane effects explicitly in calculations

    • Use QM/MM (quantum mechanics/molecular mechanics) methods to balance accuracy and computational cost

    • Include explicit solvent models where appropriate

    • Account for protein dynamics through molecular dynamics simulations

  • Improved experimental design:

    • Develop assays that more closely mimic physiological conditions

    • Use multiple complementary techniques to validate findings

    • Employ time-resolved methods to capture transient intermediates

  • Iterative approach:

    • Use experimental data to refine theoretical models

    • Generate new predictions from refined models

    • Test predictions experimentally

    • Continue refinement cycle

This iterative, integrated approach has successfully resolved contradictions between DFT-based methods and experimental data in related cobalamin-dependent enzymes, such as methionine synthase , and could be applied to better understand CobS function.

How does CobS contribute to the multienzyme complex for cobalamin biosynthesis?

Current evidence strongly suggests that CobS functions as part of a multienzyme complex associated with the cell membrane. This complex includes other enzymes involved in the late steps of cobamide biosynthesis, specifically CbiB, CobU, CobT, and CobC . Understanding CobS's role within this complex remains an active area of research.

Key research questions include:

  • Structural organization: How are the enzymes arranged within the complex, and how does this arrangement facilitate substrate channeling?

  • Protein-protein interactions: Which specific residues mediate interactions between CobS and other complex components?

  • Regulatory mechanisms: How is the activity of the complex regulated in response to cellular needs?

  • Assembly dynamics: Is the complex stably assembled, or does it form transiently in response to certain conditions?

Techniques such as protein crosslinking, co-immunoprecipitation, FRET analyses, and cryo-electron microscopy are being employed to address these questions. The results will provide insights not only into cobalamin biosynthesis but also into the broader principles of multienzyme complex organization in bacterial membranes.

What are the evolutionary implications of CobS conservation across diverse organisms?

The conservation of CobS across all cobamide-producing bacteria and archaea raises intriguing evolutionary questions:

  • Functional constraints: What specific structural or functional constraints have maintained CobS conservation despite the divergence of other pathway components?

  • Horizontal gene transfer: Has the gene for CobS been subject to horizontal gene transfer events that explain its broad distribution?

  • Co-evolution: How has CobS co-evolved with other enzymes in the pathway, particularly those with which it directly interacts?

  • Environmental adaptation: How do variations in CobS across different organisms reflect adaptations to specific environmental niches?

Comparative genomic analyses combined with structural and functional studies of CobS from diverse organisms could shed light on these evolutionary questions, potentially revealing principles applicable to other conserved biosynthetic pathways.

How can synthetic biology approaches enhance our understanding of CobS function?

Synthetic biology offers powerful tools for investigating CobS function:

  • Engineered variants:

    • Creation of chimeric enzymes combining domains from different species

    • Systematic mutagenesis to map functional regions

    • Directed evolution to identify variants with enhanced activity or altered specificity

  • Reconstituted pathways:

    • Assembly of minimal cobalamin biosynthetic pathways in heterologous hosts

    • Coupling CobS activity to reporter systems for high-throughput screening

    • Creating orthogonal pathways to study CobS function without interference from native processes

  • Novel assay development:

    • Biosensor systems that detect CobS products in vivo

    • Split-protein complementation assays to study protein-protein interactions

    • Optogenetic approaches to control CobS activity spatiotemporally

These synthetic biology approaches complement traditional biochemical and structural studies, potentially accelerating our understanding of CobS function and its integration into the broader cobalamin biosynthetic pathway.

What technological advances would accelerate CobS research?

Several technological developments would significantly advance CobS research:

  • Improved membrane protein structural biology techniques:

    • Enhanced cryo-EM methodologies for membrane protein complexes

    • Advanced crystallization methods for membrane proteins

    • Novel lipid cubic phase approaches specific for multi-spanning membrane proteins

  • High-throughput functional assays:

    • Fluorogenic or chromogenic substrates for real-time activity monitoring

    • Microfluidic platforms for rapid screening of conditions and variants

    • Automated liposome reconstitution systems

  • Advanced computational tools:

    • Improved membrane protein structure prediction algorithms

    • Enhanced molecular dynamics simulations incorporating realistic membrane environments

    • Machine learning approaches to predict structure-function relationships

  • Single-molecule techniques:

    • Methods to observe individual CobS molecules during catalysis

    • Techniques to monitor conformational changes during the catalytic cycle

    • Approaches to visualize interactions within the multienzyme complex

These technological advances would address current bottlenecks in CobS research, potentially leading to breakthroughs in understanding this important enzyme's function and regulation.

How might understanding CobS contribute to synthetic cobalamin production?

Detailed knowledge of CobS structure and function could significantly impact synthetic cobalamin production strategies:

  • Enzyme engineering:

    • Development of CobS variants with enhanced activity or stability

    • Creation of soluble CobS variants that retain activity without membrane association

    • Engineering of CobS to accept modified substrates for novel cobalamin derivatives

  • Pathway optimization:

    • Rational design of the multienzyme complex for improved efficiency

    • Balancing expression levels of pathway enzymes to avoid bottlenecks

    • Minimizing competing pathways that deplete precursors

  • Alternative production systems:

    • Cell-free production systems incorporating reconstituted CobS

    • Simplified hosts with optimized cobalamin biosynthetic pathways

    • Biohybrid approaches combining enzymatic and chemical synthesis steps

Current industrial cobalamin production relies predominantly on fermentation using natural producer strains like Propionobacterium shermanii and Pseudomonas denitrificans, with yields up to 300 mg/L . Enhanced understanding of CobS and related enzymes could potentially improve these yields or enable more efficient production systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.