Recombinant Chlorobaculum parvum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

Mechanosensitive channels (MSCs) are ubiquitous in living organisms, playing a crucial role in sensing and responding to mechanical stimuli . Among these, the Large-conductance Mechanosensitive Channel (MscL) is one of the best-studied and simplest mechanosensory molecules . MscL channels function as emergency release valves, discharging cytoplasmic solutes upon osmotic stress . This article focuses on the MscL homolog found in Chlorobaculum parvum, a green sulfur bacterium .

MscL in Bacteria

MscL is a channel protein that responds to mechanical stretch in the cell membrane . When the membrane is stretched, MscL opens, creating a large pore through which ions and small molecules can flow . This allows the cell to rapidly reduce osmotic pressure and prevent lysis . Homologs of MscL are found in various bacteria, suggesting its importance in bacterial survival .

Chlorobaculum parvum

Chlorobaculum parvum (formerly Chlorobium vibrioforme f. thiosulfatophilum) is a Gram-negative, anaerobic, photoautotrophic green sulfur bacterium . These bacteria typically oxidize sulfide or thiosulfate . C. parvum utilizes chlorobactene as its major carotenoid .

MscL Structure and Function

MscL is a relatively small protein, consisting of around 136 amino acid residues . It has two hydrophobic regions and resides in the inner membrane of the bacterium . MscL spans the membrane twice, with both termini located in the cytoplasm . Spectroscopic studies suggest that MscL is highly helical . The active channel complex is thought to be a homo-hexamer, meaning it consists of six identical MscL subunits .

MscL as an Antibacterial Target

Due to its critical role in bacterial survival, MscL has been investigated as a potential antibiotic target . Inappropriate opening of the MscL pore can be detrimental to the cell . Several compounds have been identified that modulate MscL activity, suggesting that it is a viable target for developing new antibacterial agents .

Compounds Modulating MscL

Some compounds can bind to MscL and modulate its activity . For example, two sulfonamide compounds were found to increase MscL gating, with one acting on either side of the bacterial membrane . These compounds can increase the open probability of MscL, leading to membrane permeabilization .

Research Findings

Research has shown that MscL can be directly activated by certain compounds, leading to membrane permeabilization . Electrophysiological studies using patch-clamp techniques have demonstrated increased MscL channel activity upon treatment with compounds like SCH-79797 .

CompoundOpen Probability (Control)Open Probability (Treated)p-value
Compound 011 (Periplasm)0.18 ± 0.060.86 ± 0.2< 0.026
Compound 011 (Cytoplasm)0.14 ± 0.120.83 ± 1.17< 0.008
Compound 120 (Periplasm)0.06 ± 0.050.53 ± 0.18< 0.02
Compound 120 (Cytoplasm)0.04 ± 0.010.06 ± 0.01> 0.2

These results indicate that certain compounds significantly increase MscL channel activity, suggesting that MscL is a potential target for antibacterial development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; Cpar_0951; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNVVDMAVGIIIGGAFTGIVKSLVGDVLTPPLGLLLNGVDFTNLFVVLK EGATPGPYLALEQAQSAGAVTLNYGLFINAFISFVIMAVAVFFLVRGINRLRKMTEKPPE PAAAPDTKECPFCFSAIPVKAVRCPNCTSQL
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What physiological role does MscL play in bacterial osmoregulation, and how might this function in C. parvum?

MscL serves as a critical emergency release valve during rapid osmotic downshock, preventing cell lysis by allowing the rapid efflux of cytoplasmic contents. In E. coli, studies have demonstrated that MscL opens in response to increased membrane tension, allowing the passage of water, ions, and small proteins to quickly reduce turgor pressure . This mechanism is essential for bacterial survival in environments with fluctuating osmolarity.

For C. parvum, an anoxygenic photosynthetic bacterium, the osmoregulatory function of MscL would be particularly important in its natural aquatic habitats where osmotic conditions can change rapidly. The channel likely functions similarly to its E. coli counterpart, opening when membrane tension reaches a threshold value during hypoosmotic shock. Researchers investigating C. parvum MscL should consider how the specific ecological niche of this organism might influence the evolution of its mechanosensitive properties.

How can I predict the functional characteristics of C. parvum MscL based on sequence homology?

To predict the functional characteristics of C. parvum MscL:

  • Perform multiple sequence alignment with well-characterized MscL proteins (particularly from E. coli, M. tuberculosis, and S. aureus) to identify conserved residues .

  • Focus on key functional regions:

    • Pore-lining residues (corresponding to E. coli's Leu19 and Val23)

    • Transmembrane domains that sense membrane tension

    • Cytoplasmic helices involved in gating

  • Use homology modeling software (such as SWISS-MODEL or Phyre2) with known MscL crystal structures as templates to generate a predictive structural model.

  • Calculate conservation scores to identify highly conserved regions likely crucial for function.

  • Analyze the hydrophobicity profile of transmembrane domains, as these characteristics significantly impact channel gating properties.

The resulting model can guide experimental design, particularly for site-directed mutagenesis studies targeting residues predicted to be involved in tension sensing or channel gating. Remember that sequence divergence in key regions may indicate functional adaptations specific to C. parvum's ecological niche.

What expression systems are optimal for recombinant C. parvum MscL production?

Based on successful approaches with other bacterial MscLs, the following expression systems would be recommended for C. parvum MscL:

  • E. coli expression system (recommended primary approach):

    • BL21(DE3) strain with pET vector systems provides high yields for bacterial membrane proteins

    • C43(DE3) or C41(DE3) strains are specifically designed for toxic or membrane protein expression

    • Consider using the MJF641 strain (with seven mechanosensitive channel genes deleted) for functional studies

  • Protein fusion strategies:

    • MscL-sfGFP fusion allows for easy monitoring of expression and facilitates single-molecule counting

    • His-tag or other affinity tags should be positioned carefully to avoid interfering with channel assembly

  • Expression optimization parameters:

    • Induction at lower temperatures (16-20°C) often improves membrane protein folding

    • IPTG concentration should be titrated (0.1-1.0 mM) to identify optimal induction conditions

    • Consider codon optimization of the C. parvum mscL gene for expression in E. coli

A critical consideration is the Shine-Dalgarno sequence, which significantly impacts expression levels. Research has shown that modifying this sequence can tune channel expression across three orders of magnitude , allowing researchers to systematically study the relationship between channel abundance and function.

What are the critical factors affecting the functional integrity of recombinant MscL during purification?

Maintaining the functional integrity of recombinant C. parvum MscL during purification requires careful attention to several factors:

  • Detergent selection:

    • Use mild detergents like n-Dodecyl β-D-maltoside (DDM) or n-Octyl-β-D-glucopyranoside (OG)

    • Avoid harsh detergents that might destabilize the pentameric structure

    • Consider that detergent choice has been shown to affect crystallization outcomes and potentially structure determination

  • Lipid environment preservation:

    • Supplement purification buffers with lipids (0.01-0.05% w/v) to stabilize the channel

    • Consider nanodisc or liposome reconstitution immediately following purification

  • Buffer composition:

    • Maintain physiological pH (7.0-7.5) throughout purification

    • Include osmolytes (100-300 mM glycine or sucrose) to stabilize the protein structure

    • Add reducing agents (1-5 mM DTT or TCEP) to prevent oxidation of cysteine residues

  • Temperature control:

    • Perform all purification steps at 4°C to minimize protein degradation

    • Avoid repeated freeze-thaw cycles which can disrupt the oligomeric state

  • Quality control metrics:

    • Monitor homogeneity through size-exclusion chromatography

    • Verify pentameric assembly using native PAGE or multi-angle light scattering

    • Assess functional integrity through reconstitution and patch-clamp electrophysiology

Remember that the choice of crystallization detergent has been suggested to cause structural artifacts in S. aureus MscL studies , highlighting the importance of detergent selection for structural and functional analysis.

What methods are most effective for studying the structure of C. parvum MscL?

For comprehensive structural characterization of C. parvum MscL, researchers should employ a multi-technique approach:

  • X-ray Crystallography:

    • Most successful for MscL structures from M. tuberculosis and S. aureus

    • Critical factors include:

      • Protein purity (>95% by SDS-PAGE)

      • Detergent screening (DDM, OG, LDAO)

      • Lipid supplementation during crystallization

      • Consideration of fusion partners to facilitate crystallization

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for capturing different conformational states

    • Advantages include:

      • No need for crystallization

      • Potential to visualize the channel in a more native lipid environment

      • Ability to capture the open state, which has been challenging by crystallography

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • For dynamic regions and conformational changes

    • Solution NMR for isolated domains

    • Solid-state NMR for full-length protein in membrane mimetics

  • Molecular Dynamics Simulations:

    • Complement experimental structures to model:

      • Gating transitions

      • Membrane tension effects

      • Water and ion permeation pathways

  • Site-Directed Spin Labeling and EPR Spectroscopy:

    • For measuring distances between residues in different conformational states

    • Particularly useful for tracking structural changes during gating

Each method provides unique insights, and their combination offers the most comprehensive understanding of C. parvum MscL structure. Researchers should be aware that detergent choice has been shown to potentially produce non-physiological structures, as suggested for S. aureus MscL .

How can I assess the functional properties of recombinant C. parvum MscL?

Functional characterization of recombinant C. parvum MscL can be accomplished through several complementary approaches:

  • Electrophysiological methods:

    • Patch-clamp of giant spheroplasts or reconstituted systems

    • Key parameters to measure:

      • Single-channel conductance (expected ~3 nS based on other MscLs)

      • Tension threshold for activation

      • Open probability vs. membrane tension relationship

      • Channel kinetics (open and closed dwell times)

  • Osmotic shock survival assays:

    • Express C. parvum MscL in MJF641 E. coli strain (deleted for all seven mechanosensitive channels)

    • Compare survival rates under different expression levels using modified Shine-Dalgarno sequences

    • Conduct both population-based assays and single-cell microscopy survival studies

    • Quantify relationship between channel abundance and survival probability

  • Fluorescence-based techniques:

    • FRET sensors to monitor conformational changes

    • Fluorescence-based flux assays using liposomes

    • Single-molecule tracking of MscL-fluorescent protein fusions

  • In vivo reporter systems:

    • Design assays where channel opening releases a detectable molecule

    • Couple channel activity to reporter gene expression

Based on research with E. coli MscL, expect that several hundred C. parvum MscL channels per cell would be required for significant osmotic protection, with approximately 500-700 channels needed for 80% survival probability during osmotic shock .

What are the key experimental considerations when determining the tension sensitivity of C. parvum MscL?

When investigating the tension sensitivity of C. parvum MscL, consider these critical experimental factors:

  • Membrane composition effects:

    • Systematically vary lipid composition in reconstituted systems:

      • Phosphatidylethanolamine (PE) content (30-70%)

      • Phosphatidylglycerol (PG) content (20-40%)

      • Membrane thickness (C14-C22 acyl chains)

    • Assess activation thresholds in different compositions using patch-clamp

  • Rate-dependent activation:

    • Test both slow (<1.0 Hz) and fast (≥1.0 Hz) rates of osmotic shock

    • Quantify survival probabilities at each rate across different channel expression levels

    • A key finding from E. coli MscL shows that survival probability curves shift depending on shock rate, with fast shocks requiring more channels for equivalent survival

  • Experimental tension application methods:

    • Negative pressure in patch pipettes (suction)

    • Osmotic gradients across reconstituted membranes

    • Amphipath insertion to induce membrane curvature

    • Microfluidic cell stretching devices

  • Data analysis approaches:

    • Use logistic regression to relate channel number to survival probability

    • Implement Boltzmann distribution analysis for tension-dependent activation

    • Apply Markovian models to characterize gating transitions

Shock RateApproximate MscL Channels Required for 80% Survival (E. coli data)
Slow (<1.0 Hz)~700 channels/cell
Fast (≥1.0 Hz)~500 channels/cell

Note that while these numbers are derived from E. coli MscL studies , they provide a valuable baseline for comparison with C. parvum MscL. The rate-dependent effect on survival persists even at high expression levels (nearly 1000 channels per cell), suggesting fundamental biophysical constraints rather than simple threshold effects .

How can I design patch-clamp experiments to characterize C. parvum MscL?

Designing effective patch-clamp experiments for C. parvum MscL requires careful preparation and execution:

  • Preparation of patch-clamp samples:

    • For spheroplast patches:

      • Generate giant spheroplasts from E. coli expressing C. parvum MscL

      • Treatment with lysozyme and EDTA in a sucrose-rich medium is critical

      • Aging spheroplasts for 3-4 hours often improves patch stability

    • For reconstituted systems:

      • Reconstitute purified C. parvum MscL in liposomes (3:1 PE:PG recommended)

      • Form GUVs (Giant Unilamellar Vesicles) using electroformation or gentle hydration

      • Control protein:lipid ratio carefully (1:1000 to 1:5000 by weight)

  • Patch-clamp protocols:

    • Start with cell-attached or excised-patch configurations

    • Apply negative pressure in 5-10 mmHg increments

    • Hold at each pressure for 30-60 seconds to observe channel activity

    • Record at multiple voltages (-100 to +100 mV) to establish I-V relationship

    • For mechanosensitive properties, calculate tension using Laplace's law: T = P×r/2, where T is tension, P is pressure, and r is patch radius

  • Data acquisition and analysis:

    • Use high sampling rates (≥10 kHz) with appropriate filtering (1-2 kHz)

    • Analyze single-channel conductance, open probability vs. tension, and dwell times

    • Compare activation thresholds with other mechanosensitive channels if co-expressed

  • Important controls:

    • Empty liposomes to confirm channel-specific activity

    • Well-characterized MscL (e.g., E. coli) as reference

    • Varying lipid compositions to assess environmental sensitivity

When interpreting results, note that electrophysiology studies of MscL have shown significantly lower channel counts (4-100 per cell) compared to fluorescence microscopy and quantitative Western blotting (several hundred per cell) . This discrepancy likely reflects the difference between the total number of channels present and the fraction that is functionally active under specific conditions.

How can I determine the relationship between C. parvum MscL copy number and bacterial survival during osmotic shock?

To establish the relationship between C. parvum MscL copy number and osmotic shock survival:

  • Experimental system setup:

    • Create an E. coli strain (preferably MJF641 background) with all native mechanosensitive channels deleted

    • Chromosomally integrate C. parvum mscL-sfGFP with various Shine-Dalgarno sequence modifications to achieve a range of expression levels

    • Design a flow cell system for microscopic observation of single cells during osmotic shock

  • Copy number quantification:

    • Calibrate sfGFP fluorescence using a reference standard

    • Measure single-cell fluorescence microscopically before osmotic shock

    • Consider using super-resolution microscopy for precise spatial distribution analysis

    • Alternative methods include quantitative Western blotting with purified protein standards

  • Osmotic shock protocol:

    • Culture cells in high-osmolarity medium (supplemented with 500 mM NaCl)

    • Apply controlled downshock by rapid perfusion with low-osmolarity medium

    • Test both slow (<1.0 Hz) and fast (≥1.0 Hz) shock rates as these significantly affect survival

    • Record time-lapse images to monitor cell fate (survival vs. lysis)

  • Data analysis:

    • Use logistic regression to model the relationship between channel copy number and survival probability

    • Calculate confidence intervals to account for experimental variability

    • Generate survival probability curves for different shock rates

MscL Copy Number RangeExpected Survival Probability (Based on E. coli data)
<100 channels/cellNear 0% survival observed
100-300 channels/cell20-50% survival
300-500 channels/cell50-70% survival
500-700 channels/cell70-80% survival
>700 channels/cell~80% maximum survival

Based on E. coli MscL studies, expect a threshold effect where cells with fewer than approximately 100 channels show virtually no survival, while maximum survival rates (around 80%) require 500-700 channels per cell . The remaining 20% survival may depend on the presence of other mechanosensitive channel species.

How do different rates of osmotic shock affect C. parvum MscL gating and cellular survival?

The relationship between osmotic shock rate and MscL gating represents an important area of investigation:

This research area addresses a critical question about the biophysical limits of mechanosensitive channel protection. E. coli research has shown that even at very high MscL expression levels, fast shocks still reduce survival compared to slow shocks . This suggests either: (1) inherent kinetic limitations in channel activation or (2) complex interplay between tension development, channel activation, and membrane integrity during rapid osmotic transitions.

What biophysical properties determine the conductance and selectivity of C. parvum MscL?

Understanding the biophysical determinants of C. parvum MscL conductance and selectivity requires investigation of:

  • Pore geometry and dimensions:

    • Conduct molecular dynamics simulations to estimate:

      • Pore diameter in open state (likely ~30-40 Å based on other MscLs)

      • Constriction points along the channel

      • Water and ion distributions within the pore

    • Analyze how these parameters relate to the measured conductance (~3 nS for typical MscLs)

  • Molecular determinants of selectivity:

    • Identify pore-lining residues through homology modeling

    • Perform systematic mutagenesis of these residues to alter:

      • Charge distribution

      • Hydrophobicity

      • Pore dimensions

    • Measure resulting changes in ion selectivity and conductance

  • Energy landscape of permeation:

    • Calculate potential of mean force for different permeants:

      • Monovalent cations (K+, Na+)

      • Divalent cations (Ca2+, Mg2+)

      • Anions (Cl-)

      • Small organic molecules

    • Determine energy barriers for permeation

  • Experimental approaches to measure selectivity:

    • Bi-ionic potential measurements

    • Ion competition assays

    • Asymmetric ion gradient experiments

    • Single-molecule fluorescence to track permeant molecules

This research would address the fundamental question of why MscL has evolved such a large conductance (3 nS) compared to other channels. The evolutionary advantage may relate to the need for rapid cytoplasmic content release during extreme osmotic downshock, requiring a large-diameter pore with minimal selectivity filter restrictions.

How might C. parvum MscL interact with other mechanosensitive channels in a coordinated response to osmotic stress?

Investigating potential coordination between C. parvum MscL and other mechanosensitive channels:

  • Expression correlation analysis:

    • Perform transcriptomic and proteomic analyses across various osmotic conditions

    • Identify co-expression patterns between MscL and other mechanosensitive channels (MscS, MscK, etc.)

    • Determine if expression ratios remain constant or change with environmental conditions

  • Functional coordination experiments:

    • Co-reconstitute C. parvum MscL with other mechanosensitive channels

    • Apply varied tension protocols to determine:

      • Activation order and thresholds

      • Potential cooperative or competitive interactions

      • Combined contribution to osmotic protection

  • Membrane microdomain organization:

    • Investigate potential co-localization using super-resolution microscopy

    • Assess lipid raft association through detergent resistance assays

    • Determine if channels form functional clusters or are randomly distributed

  • Predicted interaction model:

    • Based on existing E. coli data, the following coordination model might apply:

      • MscS activates at lower tensions (~6 mN/m) than MscL (~12 mN/m)

      • MscL provides a final emergency response when other channels are insufficient

      • The combined effect may explain why MscL alone provides only ~80% maximum survival

Channel TypeTypical Activation ThresholdConductancePrimary Role in Protection
MscMLowest tension~0.3 nSInitial response
MscSIntermediate tension~1 nS~50% protection alone
MscLHighest tension~3 nS~80% protection alone

Research on E. coli mechanosensitive channels suggests that MscL alone provides a maximum of ~80% protection against osmotic shock , while MscS alone provides ~50% protection. This implies that the combined action of multiple channel types is required for complete osmotic protection, highlighting the importance of understanding their coordinated function.

What emerging technologies could advance our understanding of C. parvum MscL structure and function?

Several cutting-edge technologies hold promise for deeper insights into C. parvum MscL:

  • Time-resolved cryo-EM:

    • Capture transient conformational states during channel gating

    • Visualize the transition pathway from closed to open states

    • Potential to resolve the complete conformational landscape

  • Advanced fluorescence techniques:

    • Single-molecule FRET with strategically placed fluorophores

    • Fluorescence correlation spectroscopy to measure conformational dynamics

    • Super-resolution microscopy to visualize channel clustering and distribution

  • Artificial intelligence applications:

    • Deep learning for improved structure prediction

    • Machine learning to identify patterns in electrophysiological data

    • AI-guided protein engineering to enhance desired properties

  • High-throughput mutagenesis:

    • Deep mutational scanning to comprehensively map structure-function relationships

    • CRISPR-based screening for phenotypic effects of mutations

    • Automated patch-clamp for rapid functional characterization

  • Nanotechnology approaches:

    • Nanoscale force probes to directly measure channel mechanics

    • 3D-printed microfluidics for precise control of membrane tension

    • Nanodiscs with precisely controlled lipid composition for reconstitution studies

These technologies could help resolve current gaps in our understanding, such as the discrepancy between theoretical predictions suggesting only a few channels should be sufficient for protection versus experimental findings showing hundreds are needed . Novel approaches may also elucidate the rate-dependent effects observed in osmotic protection studies.

How can insights from C. parvum MscL research be applied to biosensor development or synthetic biology?

Knowledge of C. parvum MscL could be leveraged for innovative applications:

  • Tension-sensitive biosensors:

    • Engineer C. parvum MscL variants with fluorescent reporters that signal channel opening

    • Applications include:

      • Real-time monitoring of membrane tension in living cells

      • Detection of osmotic stress in industrial bioprocesses

      • Screening compounds that affect membrane properties

  • Controlled release systems:

    • Design reconstituted liposomes with engineered MscL for controlled cargo release

    • Trigger release through:

      • Osmotic gradients

      • Temperature-sensitive lipids that alter membrane tension

      • Light-activated amphipaths that modulate membrane properties

  • Synthetic mechanosensitive circuits:

    • Create genetic circuits where MscL activation triggers gene expression

    • Design bacteria that respond to mechanical stimuli by producing therapeutics or diagnostics

    • Develop feedback systems where channel opening regulates osmolyte production

  • Comparative evolutionary insights:

    • Study how C. parvum MscL adaptations reflect its ecological niche

    • Identify principles for engineering mechanosensitive systems with specific properties

    • Extract design principles for synthetic tension-sensing modules

The quantitative relationship established between channel copy number and survival probability in E. coli MscL (requiring 500-700 channels for 80% survival) provides crucial design parameters for synthetic systems, ensuring adequate protection while minimizing metabolic burden.

Integrating knowledge from multiple mechanosensitive channel types might enable the design of synthetic cell systems with customized responses to mechanical stimuli, potentially advancing fields from drug delivery to environmental sensing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.