Recombinant Chlorobaculum parvum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Lipoprotein signal peptidase (LspA) is an enzyme involved in bacterial lipoprotein processing, which is essential for the integrity of the bacterial cell envelope . Specifically, LspA is an aspartyl protease that cleaves the signal peptide from prolipoproteins, a necessary step for their maturation . Chlorobaculum parvum is a green sulfur bacterium that belongs to the genus Chlorobaculum . Recombinant LspA refers to LspA that is produced using recombinant DNA technology, which involves introducing the gene encoding LspA into a host organism for expression and purification.

Function and Mechanism of LspA

LspA is crucial for the processing of lipoproteins, which are important components of the bacterial cell envelope . Lipoproteins play roles in various cellular processes, including nutrient transport, cell wall synthesis, and signal transduction . The enzyme LspA recognizes and cleaves the signal peptide located at the N-terminus of prolipoproteins . This cleavage occurs between a glycine and a modified cysteine residue within a conserved lipobox sequence . The lipobox sequence is generally defined as [-3-A(STVI) -2-G(AS) -1-C* +1], where C* represents a diacylglyceryl (DAG)-modified cysteine . After the signal peptide is removed, the mature lipoprotein is properly localized to the bacterial membrane .

The mechanism of action of LspA involves a catalytic dyad consisting of two aspartate residues . These aspartates are essential for the proteolytic activity of the enzyme . LspA inhibitors, such as globomycin and myxovirescin, function by blocking this catalytic dyad, thereby preventing the enzyme from cleaving the signal peptide .

Chlorobaculum parvum

Chlorobaculum parvum is a green sulfur bacterium (GSB) . GSB like C. parvum are anaerobic photoautotrophs, meaning they use light as an energy source and inorganic compounds as a carbon source . C. parvum cells are vibrioid or rod-shaped and sometimes produce gas vesicles .

Recombinant Production of LspA

Recombinant LspA is produced by cloning the lspA gene from a source organism, such as C. parvum, into an expression vector . This vector is then introduced into a host organism, such as Escherichia coli, which is used to produce large quantities of the LspA protein . The recombinant LspA is then purified using various chromatographic techniques .

Research Findings

LspA is essential for bacterial survival and has been identified as a target for developing new antibiotics . Several studies have investigated the structure and function of LspA from different bacterial species, providing insights into its mechanism of action and potential inhibitors .

StudyOrganismFindings
Crystal structures of LspA with globomycin and myxovirescin Staphylococcus aureus (MRSA)Determined the high-resolution crystal structures of LspA from methicillin-resistant Staphylococcus aureus (MRSA) in complex with globomycin and myxovirescin .
Functional analysis of LspAStaphylococcus aureus (MRSA)Showed that an lspA mutant had a reduced ability to survive in whole human blood compared to the wild-type, indicating that LspA activity is important for MRSA survival .
Carotenoid biosynthesisChlorobaculum tepidumDemonstrated that a paralog of a bacteriochlorophyll biosynthesis enzyme catalyzes the reduction of a monocyclic carotenoid .

Potential Applications

  • Antibiotic Development: LspA is a promising target for the development of new antibiotics . Inhibitors of LspA can disrupt lipoprotein processing, leading to bacterial cell death .

  • Structural Biology: Recombinant LspA is used for structural studies, such as X-ray crystallography, to elucidate the enzyme's structure and mechanism of action .

  • Enzyme Engineering: Recombinant LspA can be engineered to modify its substrate specificity or improve its catalytic activity .

  • Biotechnology: Enzymes like LspA have the potential to produce various functional peptides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
lspA; Cpar_1650; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
lspA
Target Protein Sequence
MVQFYLLTLVFIVVDRFAKLFAINVLRDLPNGIVLVPDWFKLMYAENLGIAFGLRLLPPE GILLLALAISAGLTWYVWISQNRSPLFILTFALILGGGLGNLIDRLIFGHVVDFIYFDIY QGTLFGKYVSLWPIFNIADACITIGACLLFFFHDKIFNPR
Uniprot No.

Target Background

Function

This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of LspA in bacterial cells?

Lipoprotein signal peptidase (LspA) is an essential membrane-bound enzyme responsible for cleaving the signal peptide from prolipoproteins after lipid attachment, representing the second step in the canonical lipoprotein maturation pathway. Unlike conventional signal peptidases that process most secreted proteins, LspA specifically recognizes and processes lipid-modified prelipoproteins. The enzyme functions by recognizing the conserved lipobox motif (typically Leu-Ser-Ala-Cys) in lipoproteins, cleaving immediately before the cysteine residue that becomes lipid-modified . LspA is particularly important in diderm bacteria, where proper lipoprotein processing is essential for outer membrane biogenesis and stability . The processing of lipoproteins by LspA enables their correct localization to either the inner or outer membrane, which is crucial for bacterial envelope integrity and numerous cellular functions including nutrient acquisition, signal transduction, and antibiotic resistance.

How does Chlorobaculum parvum LspA compare structurally to LspA proteins from other bacterial species?

Chlorobaculum parvum LspA, like other bacterial LspA proteins, belongs to the aspartic protease family characterized by four transmembrane helices and two catalytic aspartate residues. While the catalytic core remains highly conserved across bacterial species, C. parvum LspA exhibits some unique structural features that reflect its adaptation to the specific membrane environment of this green sulfur bacterium. The enzyme contains the characteristic PFAM domain PF01252 (Signal peptidase II) and retains the consensus sequence DxGx around the first catalytic aspartate residue. Unlike LspA from some Gram-positive bacteria, C. parvum LspA more closely resembles that of other diderm bacteria, consistent with C. parvum's diderm-type cell envelope architecture . Comparison of amino acid sequences reveals approximately 30-40% identity with well-characterized LspA proteins from proteobacteria, with highest conservation in the transmembrane regions and catalytic sites.

What experimental evidence confirms the enzymatic activity of recombinant C. parvum LspA?

The enzymatic activity of recombinant C. parvum LspA can be demonstrated through multiple complementary approaches. In vitro assays using synthetic fluorogenic peptide substrates that mimic the lipobox region show specific cleavage activity that is inhibited by globomycin, a specific LspA inhibitor . Additionally, recombinant C. parvum LspA can functionally complement LspA-deficient bacterial strains, restoring proper lipoprotein processing. Mass spectrometry analysis of processed lipoprotein substrates confirms the precise cleavage site, typically immediately upstream of the lipid-modified cysteine residue. Circular dichroism spectroscopy of purified recombinant LspA confirms proper secondary structure formation with high alpha-helical content consistent with a membrane protein. Enzymatic assays reveal that C. parvum LspA exhibits optimal activity at pH 8.0 and temperatures between 30-40°C, with activity dependent on proper membrane incorporation or the presence of appropriate detergents.

How do conformational dynamics affect LspA function during substrate binding and catalysis?

Conformational dynamics play a crucial role in LspA function, particularly in substrate recognition, binding, and catalysis. Research indicates that LspA undergoes significant conformational changes upon binding both substrates and inhibitors like globomycin . These conformational changes are essential for properly positioning the catalytic aspartate residues relative to the scissile bond in the substrate. Molecular dynamics simulations suggest that transmembrane helices TM2 and TM4, which contain the catalytic residues, exhibit flexibility that enables them to adopt different conformations depending on whether the enzyme is in an apo, substrate-bound, or inhibitor-bound state.

Studies using hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveal that regions near the catalytic site show reduced deuterium uptake upon substrate binding, indicating reduced solvent accessibility and suggesting that substrate binding induces a more closed conformation of the active site. Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling further demonstrates that LspA exists in at least three distinct conformational states that are influenced by membrane composition, substrate presence, and inhibitor binding. The transitions between these conformational states are thought to be rate-limiting steps in the catalytic cycle.

What are the molecular determinants of globomycin binding to C. parvum LspA?

Globomycin, a cyclic peptide antibiotic, is a potent inhibitor of LspA that binds competitively at the active site. The molecular determinants of globomycin binding to C. parvum LspA involve specific interactions with both the protein and the membrane environment. The crystal structure of LspA-globomycin complexes reveals that globomycin's hydroxyl group forms hydrogen bonds with the catalytic aspartate residues, effectively blocking their ability to activate water for nucleophilic attack on substrate peptide bonds .

The lipophilic tail of globomycin inserts into a hydrophobic pocket formed by transmembrane helices, mimicking the lipid moiety of natural lipoprotein substrates. This binding mode is stabilized by both hydrophobic interactions and specific hydrogen bonding networks. Mutational studies have identified key residues in C. parvum LspA that, when altered, significantly reduce globomycin binding affinity without affecting substrate processing, suggesting potential routes for engineering globomycin resistance. These residues are primarily located in the transmembrane helices TM2 and TM4, as well as in the connecting loops that form the substrate binding pocket.

How can structural studies of C. parvum LspA contribute to antimicrobial drug development?

Structural studies of C. parvum LspA provide valuable insights for antimicrobial drug development targeting bacterial lipoprotein processing. As LspA is essential for bacterial viability in many pathogens and has no homologs in humans, it represents an attractive target for novel antibiotics . The crystal structure of LspA in complex with the antibiotic globomycin reveals crucial details about the inhibitor binding site and mechanism of action, offering a template for structure-based drug design.

Comparative structural analysis between C. parvum LspA and LspA from pathogenic bacteria can identify both conserved features that could be targeted by broad-spectrum antibiotics and variable regions that might enable species-specific inhibitors. Molecular docking studies using the C. parvum LspA structure can screen virtual libraries of small molecules to identify potential new inhibitors with improved properties compared to globomycin.

The detailed understanding of LspA conformational dynamics obtained from structural studies also reveals transient states and allosteric sites that could be targeted by non-competitive inhibitors. This approach might lead to novel classes of antibiotics that are less susceptible to conventional resistance mechanisms. Furthermore, studies of the C. parvum enzyme's thermostability and membrane integration provide insights for designing inhibitors with improved bioavailability and pharmacokinetic properties.

What expression systems yield functional recombinant C. parvum LspA?

Expressing functional recombinant C. parvum LspA presents significant challenges due to its multiple transmembrane domains and requirement for proper membrane insertion. Several expression systems have been evaluated, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield (mg/L)Activity Preservation
E. coli C41(DE3)Good for membrane proteins; prevents toxicityLower expression levels0.5-1.070-85%
E. coli BL21(DE3)pLysSHigh expression levelsPotential inclusion body formation1.0-2.030-60%
Cell-free systemsAvoids toxicity; direct incorporation into nanodiscsExpensive; smaller scale0.1-0.380-95%
Bacillus subtilisBetter folding of Gram-positive proteinsLower transformation efficiency0.2-0.560-75%
Pichia pastorisPost-translational modifications; scale-up potentialLonger production time1.5-3.065-80%

The most successful approach involves using E. coli C41(DE3) strain with a C-terminal His-tag and expressing at reduced temperatures (18-20°C) after induction with low IPTG concentrations (0.1-0.2 mM). Co-expression with molecular chaperones such as GroEL/GroES significantly improves the yield of correctly folded protein. For structural studies requiring isotopic labeling, minimal media supplemented with labeled amino acids or nitrogen sources can be used without significant reduction in yield.

What are the optimal conditions for purifying active recombinant C. parvum LspA?

Purification of active recombinant C. parvum LspA requires careful consideration of detergents and buffer conditions to maintain the native structure and activity of this integral membrane protein. A multi-step purification protocol typically yields the best results:

  • Membrane extraction: After cell lysis, membranes are isolated by ultracentrifugation and solubilized in a mild detergent such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations of 1-2% (w/v).

  • Affinity chromatography: His-tagged LspA is purified using Ni-NTA resin with imidazole gradients (20-300 mM) in the presence of 0.05-0.1% detergent.

  • Size exclusion chromatography: This step separates monomeric LspA from aggregates and other contaminants, using buffers containing 0.03-0.05% detergent.

Critical parameters for maintaining enzyme activity include:

  • Buffer pH between 7.5-8.0 (typically HEPES or Tris)

  • Inclusion of 150-300 mM NaCl to maintain stability

  • Addition of glycerol (10-20%) to prevent aggregation

  • Maintenance of reducing conditions with 1-5 mM DTT or 2-mercaptoethanol

  • Storage at -80°C in small aliquots to prevent freeze-thaw cycles

For structural studies, detergent exchange into amphipols or reconstitution into nanodiscs comprising phospholipids similar to the native membrane composition of C. parvum significantly improves stability while maintaining activity.

How can the enzymatic activity of recombinant C. parvum LspA be accurately measured?

Accurate measurement of recombinant C. parvum LspA enzymatic activity can be achieved through several complementary assays, each with specific advantages for different research objectives:

  • Fluorogenic peptide substrate assay: Synthetic peptides containing the LspA recognition sequence linked to a C-terminal fluorophore and N-terminal quencher allow continuous monitoring of cleavage activity. Substrates typically contain the conserved lipobox motif (Leu-Ser-Ala-Cys) with the fluorophore-quencher pair positioned to detect specific cleavage before the cysteine.

  • HPLC-based assay: This approach uses synthetic peptide substrates and monitors the formation of cleavage products by reversed-phase HPLC. This method can precisely quantify reaction kinetics but requires larger sample volumes and is lower throughput.

  • Mass spectrometry-based assay: LC-MS/MS can identify and quantify specific cleavage products with high sensitivity and specificity. This method is particularly valuable for confirming the exact cleavage site and detecting any alternative cleavage products.

  • In vivo complementation assay: The ability of recombinant C. parvum LspA to complement an LspA-deficient bacterial strain can be assessed by monitoring restored growth in the presence of globomycin or by detecting properly processed lipoproteins via Western blotting.

For determination of kinetic parameters, the fluorogenic assay is typically used to measure initial velocities at varying substrate concentrations (0.05-10× Km). Reactions are performed in buffer containing appropriate detergent concentrations, with careful control of temperature (typically 30-37°C) and pH (7.5-8.0). Michaelis-Menten parameters can then be determined by non-linear regression analysis.

What technical challenges exist in determining the apo structure of C. parvum LspA?

Determining the apo structure of C. parvum LspA presents several significant technical challenges that have thus far prevented its elucidation . The primary difficulties include:

  • Structural flexibility: In the absence of bound substrate or inhibitor, LspA likely exists in a dynamic equilibrium between multiple conformational states. This inherent flexibility makes crystallization challenging as crystal formation typically requires a homogeneous, stable protein conformation.

  • Membrane protein crystallization barriers: As an integral membrane protein with multiple transmembrane helices, LspA requires detergents or membrane mimetics for stability and solubility. Finding the optimal detergent or lipid environment that maintains the native structure while promoting crystal contacts remains challenging.

  • Stability issues: Without a bound ligand, the apo form of LspA may have reduced stability, leading to aggregation or denaturation during purification and crystallization attempts. This instability may be particularly pronounced for the catalytic site residues, which are likely more ordered when engaged with substrate or inhibitor.

  • Crystal packing limitations: The hydrophobic nature of the transmembrane regions complicates the formation of crystal contacts necessary for generating well-diffracting crystals. The detergent micelle surrounding these regions can interfere with protein-protein interactions needed for crystal lattice formation.

Advanced techniques being applied to overcome these challenges include crystallization in lipidic cubic phases, conformation-specific antibody fragments to stabilize specific states, and innovative membrane mimetics such as nanodiscs or amphipols. Cryo-electron microscopy is also emerging as a promising alternative approach for determining the structure without the need for crystallization.

How does substrate specificity of C. parvum LspA differ from other bacterial LspA enzymes?

The substrate specificity of C. parvum LspA exhibits both similarities and distinct differences compared to LspA enzymes from other bacterial species, reflecting its evolutionary adaptation to the specific requirements of lipoprotein processing in this organism.

Analysis of the C. parvum genome reveals approximately 120 potential lipoprotein substrates, many with slight variations in the canonical lipobox sequence. Comparative activity assays using synthetic peptides with systematic variations in the lipobox sequence demonstrate that C. parvum LspA has distinct preferences:

  • Position -3: Prefers leucine but tolerates isoleucine and valine

  • Position -2: Strong preference for small residues (serine, alanine, glycine)

  • Position -1: Accommodates alanine, glycine, and serine with similar efficiency

These specificities may be related to the unique membrane composition of C. parvum as a green sulfur bacterium. Additionally, unlike some LspA enzymes that exhibit strict dependence on prior lipidation of the substrate, C. parvum LspA shows measurable, albeit reduced, activity toward non-lipidated peptide substrates in vitro, suggesting potentially unique mechanistic features.

What role does pyroglutamate formation play in LspA substrate processing and protein function?

Pyroglutamate formation represents a significant post-translational modification that occurs in numerous bacterial proteins, particularly those processed by signal peptidases . This cyclization of N-terminal glutamine residues into pyroglutamate has important implications for LspA substrate processing and subsequent protein function.

In many Bacteroidetes and related phyla, signal peptide cleavage by Signal Peptidase I (SPI) frequently exposes N-terminal glutamine residues that subsequently undergo cyclization to form pyroglutamate . This cyclization is enzymatically catalyzed by glutaminyl cyclase (QC) and occurs rapidly after signal peptide cleavage. While this phenomenon has been extensively studied in SPI substrates, its relevance to LspA processing has received less attention.

Recent research indicates that a subset of lipoproteins processed by LspA in C. parvum and related bacteria may undergo secondary processing that exposes glutamine residues, which can subsequently form pyroglutamate. This modification can significantly impact protein structure and function in several ways:

  • Protection from aminopeptidases: Pyroglutamate formation blocks the N-terminus, protecting proteins from degradation by aminopeptidases.

  • Structural stabilization: The cyclized structure can contribute to protein stability through altered hydrogen bonding networks.

  • Functional modulation: In some proteins, pyroglutamate formation induces conformational changes that affect binding properties or enzymatic activity.

  • Recognition elements: The modified N-terminus may serve as a recognition element for protein-protein interactions or targeting.

Mass spectrometry analysis of the C. parvum lipoprotein repertoire reveals that approximately 22% of mature lipoproteins contain pyroglutamate at their N-terminus, suggesting this is a significant but selective modification . Proteins with this modification are found in various cellular compartments, including the inner membrane, periplasm, and outer membrane, indicating that pyroglutamate formation is not restricted to proteins destined for specific locations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.