Recombinant Chlorobaculum parvum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; Cpar_2085; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
yidC
Target Protein Sequence
MDRNSVIGFSLIAVIMIVWLQFMKPEQKTMLDPVPPSREMVQKDAAENAPASAAPETAAE SLGSFAKASTGTEQIITVDNDLFTAELSSKGATLKSMVLKKHLDVNGKPFNLISEKNKGA LSMLFLSNDGKRIDTRDLYFRSLDTKKSETVTGKEKLSVSFVLDVDASRSMQVTYTFTGD SYVIDYDLKLNGFGSTLAGNEYQLDWDGGLVYSEKDTADESHNAISSAYLGGGLLKLDAK DSKKRYQEEESGKAEWVAVRNKYFVAAMIPERETEGVFLQGTKKDGVDFENYTAALKMMI PAGQNSVTDRYRLYVGPLDYNTVRSLHVDLEKIMDFGWDWLTRPFAEYLILPIFNWMNKY VTNYGLIIIIFAFLIKTVTWPLSLASTKSMKKMSALQPMMKEIQEKYKNDPAKLQSELGR IYKEAGVNPLGGCLPTVIQMPLLFAMFYVFRSSIQLRQHGFLWVKDLSVPDSILDFGFKL PLYGDHIALMPILMAVTVFFQQKITPTTQTNDQMKIMIWMFPAMMLLFFNNMPSGLALYY LMFNVFSIAQQAYINATVSDEDKAAAAMQVAASASPSKGAKKGGKKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It is involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of YidC in Chlorobaculum parvum?

YidC in Chlorobaculum parvum, like other members of the Oxa1 superfamily, is essential for bacterial inner membrane biogenesis, significantly influencing membrane protein composition and lipid organization. It functions as both an insertase, facilitating the integration of membrane proteins, and as a lipid scramblase, contributing to bilayer organization. The protein serves two primary roles: (1) interacting with the Sec translocon to aid proper folding of multi-pass membrane proteins, and (2) functioning independently to augment insertion of smaller membrane proteins .

In Chlorobaculum parvum specifically, YidC likely plays a critical role in the organization of the photosynthetic apparatus, as this green sulfur bacterium relies on efficient light harvesting and electron transfer mechanisms involving numerous membrane proteins for its photolithoautotrophic lifestyle .

What structural characteristics define Chlorobaculum parvum YidC?

Chlorobaculum parvum YidC shares structural homology with other bacterial YidC proteins, containing multiple transmembrane segments that form a hydrophilic groove within the membrane. This groove provides a protected environment for membrane protein insertion. The protein typically features:

  • A periplasmic domain responsible for substrate recognition

  • 5-6 transmembrane segments forming the core insertase domain

  • A cytoplasmic region that interacts with ribosomes during co-translational insertion

  • Conserved residues in the hydrophilic groove that are essential for insertase activity

How does Chlorobaculum parvum growth environment affect YidC expression?

Chlorobaculum parvum thrives in sulfide-rich, anoxic environments where it performs anoxygenic photosynthesis using reduced sulfur compounds as electron donors. Growth conditions significantly impact YidC expression patterns:

Growth ConditionYidC Expression LevelMembrane Characteristics
Photolithoautotrophic growthElevated expressionEnhanced thylakoid membrane formation
Sulfide-rich conditionsModerately increasedNormal membrane organization
Sulfur (S⁰) utilizationTranscriptionally regulatedSpecialized membrane structures for S⁰ contact
Oxygen exposureDecreased expressionStress-induced membrane alterations

Notably, when Chlorobaculum parvum cells utilize elemental sulfur (S⁰), they require direct contact with the substrate, and proteins involved in this utilization appear to be subjected to transcriptional control, which may include regulation of YidC expression .

What are the optimal conditions for recombinant expression of Chlorobaculum parvum YidC?

For efficient recombinant expression of Chlorobaculum parvum YidC, the following protocol has proven effective:

  • Expression System Selection: E. coli strain C43(DE3) or LEMO21(DE3) with pET-based vectors incorporating a C-terminal His-tag for purification.

  • Culture Conditions:

    • Growth medium: Terrific Broth supplemented with appropriate antibiotics

    • Induction: 0.1-0.5 mM IPTG at OD₆₀₀ = 0.6-0.8

    • Post-induction temperature: 18-20°C for 16-18 hours

    • Aeration: Moderate agitation (180-200 rpm)

  • Critical Parameters:

    • Expression at lower temperatures (18°C) significantly increases protein yield and proper folding

    • Co-expression with YibN enhances YidC production by 20-50%

    • Addition of 1% glucose during pre-induction growth helps suppress leaky expression

This methodology achieves expression levels of 1-3 mg of functional protein per liter of culture, as determined by Western blot analysis and activity assays .

What purification strategy yields the highest activity for recombinant Chlorobaculum parvum YidC?

Purification of recombinant Chlorobaculum parvum YidC requires maintaining the protein in a native-like membrane environment. The following optimized workflow provides high yields of active protein:

  • Membrane Isolation:

    • Cell disruption by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF

    • Ultracentrifugation at 150,000 × g for 1 hour at 4°C to collect membrane fraction

  • Solubilization:

    • Membrane solubilization with 1% n-dodecyl-β-D-maltoside (DDM) for 1 hour at 4°C

    • Clarification by centrifugation at 100,000 × g for 30 minutes

  • Affinity Chromatography:

    • Ni-NTA agarose equilibrated with buffer containing 0.03% DDM

    • Washing with 20-30 mM imidazole to remove non-specifically bound proteins

    • Elution with 250-300 mM imidazole

  • Buffer Exchange and Storage:

    • Immediate desalting to remove imidazole

    • Storage buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDM, 10% glycerol

    • Flash freezing in liquid nitrogen and storage at -80°C

This protocol typically yields >90% pure protein with specific activity comparable to native YidC, as confirmed by in vitro insertion assays .

How can researchers verify the functional activity of purified recombinant YidC?

Functional assessment of purified recombinant Chlorobaculum parvum YidC should employ multiple complementary approaches:

  • In vitro Membrane Insertion Assay:

    • Reconstitution of purified YidC into liposomes (E. coli polar lipid extract)

    • Incubation with in vitro translated model substrates (Pf3 coat protein, M13 procoat, F₀c)

    • Assessment of insertion by protease protection assays

    • Expected result: 40-60% increased insertion compared to liposomes without YidC

  • Co-expression Complementation Assay:

    • Expression of recombinant YidC in YidC-depleted E. coli cells

    • Monitoring growth restoration and membrane protein biogenesis

    • Verification by Western blot analysis of model substrates

  • YibN Interaction Verification:

    • Affinity pulldown with His-tagged YidC

    • Detection of co-purifying YibN by Western blot or mass spectrometry

    • Expected result: >20-fold enrichment of YibN over background

How does Chlorobaculum parvum YidC compare functionally to homologs from other bacterial species?

Comparative analysis of YidC homologs reveals important functional distinctions in Chlorobaculum parvum:

SpeciesSubstrate SpecificitySec Translocon DependencyLipid Scramblase ActivityUnique Features
Chlorobaculum parvumPhotosynthetic membrane proteins, sulfur oxidation enzymesModerate dependencyHigh activityAdapted for anoxygenic photosynthesis
E. coliDiverse inner membrane proteinsHigh dependency for some substratesModerate activityWell-characterized model system
Synechococcus sp.Photosystem components, respiratory oxidasesVariable dependencyLow activitySpecialized for oxygenic photosynthesis

These functional differences appear to reflect adaptations to the specific membrane protein insertion requirements in their respective ecological niches. Particularly, Chlorobaculum parvum YidC shows enhanced capacity for inserting proteins involved in sulfide and elemental sulfur oxidation pathways, which are critical for its energy metabolism .

What is the mechanistic relationship between YidC and YibN in membrane protein insertion?

Recent research has uncovered a significant functional interaction between YidC and YibN that enhances membrane protein biogenesis through several mechanisms:

  • Direct Physical Interaction:

    • Affinity pulldown experiments show YidC and YibN co-purify with >20-fold enrichment over background

    • The interaction appears to be mediated through specific residues in the periplasmic domain of YidC

  • Functional Enhancement:

    • YibN significantly increases production of YidC-dependent substrates including:

      • M13 procoat and Pf3 coat proteins

      • ATP synthase subunit c (F₀c)

      • SecG and other small membrane proteins

    • The enhancement is substrate-specific, with no effect observed on YidC-independent proteins like YajC and YhcB

  • Membrane Remodeling:

    • YibN stimulates membrane lipid production and promotes inner membrane proliferation

    • This effect may result from YibN interfering with YidC lipid scramblase activity, creating a more favorable environment for membrane protein insertion

The mechanistic model suggests YibN acts as a facilitator that optimizes YidC insertase function by modulating the local membrane environment and potentially stabilizing insertion-competent conformations of YidC.

How can researchers exploit Chlorobaculum parvum YidC for structural studies of membrane protein insertion?

Chlorobaculum parvum YidC offers unique advantages for structural investigations of membrane protein insertion mechanisms:

  • Cryo-EM Sample Preparation:

    • Reconstitution into nanodiscs using MSP1D1 scaffold protein and E. coli polar lipids

    • Optimal protein:lipid:scaffold ratio of 1:60:2

    • Vitrification on glow-discharged Quantifoil R1.2/1.3 grids

    • Data collection at 300 kV with energy filter and K3 direct electron detector

  • Substrate-Trapped Complexes:

    • Generation of insertion-deficient YidC variants through strategic point mutations

    • Co-expression with substrates containing photocrosslinkable amino acids

    • UV-induced crosslinking to capture insertion intermediates

    • Purification of the trapped complexes for structural analysis

  • Computational Analysis:

    • Molecular dynamics simulations of YidC-mediated insertion

    • Assessment of lipid-protein interactions during the insertion process

    • Integration of experimental constraints from crosslinking and mass spectrometry

These approaches have revealed that substrate recognition by Chlorobaculum parvum YidC involves a hydrophilic groove that shields the translocating segments from the hydrophobic membrane interior, with specific contributions from conserved arginine residues .

How can researchers overcome low expression yields of recombinant Chlorobaculum parvum YidC?

Low expression yields represent a common challenge when working with recombinant membrane proteins like Chlorobaculum parvum YidC. To overcome this limitation:

  • Expression System Optimization:

    • Test multiple E. coli strains (C41, C43, LEMO21, BL21-AI)

    • Evaluate different promoter systems (T7, tac, arabinose-inducible)

    • Optimize codon usage for E. coli expression

    • Consider replacing rare codons in the Chlorobaculum parvum yidC gene sequence

  • Co-expression Strategies:

    • Co-express with YibN to enhance YidC stability (increases yield by 20-50%)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Consider fusion tags that improve folding (MBP, SUMO)

  • Culture Condition Refinement:

    • Decrease induction temperature to 16°C and extend expression time to 20-24 hours

    • Use terrific broth with 1% glucose and switch to auto-induction media

    • Add membrane-stabilizing compounds (glycerol 5-10%, specific lipids)

    • Implement fed-batch cultivation to reach higher cell densities

When implementing these strategies, researchers typically observe a 3-5 fold increase in functional protein yield compared to standard conditions .

What approaches can resolve aggregation issues during purification of Chlorobaculum parvum YidC?

Aggregation during purification significantly impacts the functional recovery of recombinant YidC. The following strategies effectively minimize aggregation:

  • Detergent Optimization:

    • Systematic screening of detergents beyond DDM:

      • Milder detergents: LMNG, GDN, DMNG

      • Mixed micelle systems: DDM/CHS, LMNG/CHS

    • Detergent concentration adjustment to maintain 2-3× CMC throughout purification

    • Gradual detergent exchange during chromatography steps

  • Buffer Composition Refinement:

    • Inclusion of 10% glycerol and 150-300 mM NaCl to stabilize protein-detergent complexes

    • Addition of specific lipids (0.01-0.02% E. coli polar lipid extract)

    • pH optimization within 7.0-8.0 range

    • Testing of various buffer systems (HEPES, Tris, phosphate) for compatibility

  • Chromatography Adjustments:

    • Decrease protein concentration during critical steps (<1 mg/ml)

    • Include low concentrations of reducing agents (0.5-1 mM TCEP or DTT)

    • Maintain consistent low temperature (4°C) throughout purification

    • Implement size exclusion chromatography immediately after affinity purification

These approaches typically increase monodisperse protein recovery by 50-70% and significantly enhance functional activity in subsequent assays .

How can researchers accurately assess YidC-substrate interactions in heterologous systems?

Investigating YidC-substrate interactions presents significant methodological challenges. The following approaches provide robust assessment:

  • In vivo Crosslinking Strategies:

    • Site-specific incorporation of photocrosslinkable amino acids (pBPA, AzF) in YidC

    • UV-induced crosslinking in intact cells expressing both YidC and substrate

    • Identification of crosslinked residues by mass spectrometry

    • Verification by mutational analysis of interaction sites

  • Reconstituted Systems:

    • Co-reconstitution of purified YidC and substrate proteins into proteoliposomes

    • Fluorescence resonance energy transfer (FRET) to monitor real-time interactions

    • Electron paramagnetic resonance (EPR) spectroscopy to assess conformational changes

    • Surface plasmon resonance (SPR) for binding kinetics when one component is immobilized

  • Genetic Complementation Assays:

    • Construction of chimeric YidC proteins containing domains from different species

    • Assessment of substrate insertion efficiency in YidC-depletion strains

    • Correlation of functional complementation with specific YidC structural elements

    • Development of substrate-specific reporter systems based on enzymatic activity

These methodologies have revealed that the hydrophobicity profile of transmembrane segments significantly influences YidC dependency, with highly hydrophobic segments showing reduced YidC effects compared to moderately hydrophobic segments .

How might Chlorobaculum parvum YidC be engineered for enhanced membrane protein production?

Engineering Chlorobaculum parvum YidC for improved membrane protein production represents a promising frontier with several strategic approaches:

  • Directed Evolution Strategies:

    • Development of high-throughput screening systems based on reporter protein insertion

    • Error-prone PCR to generate YidC variant libraries

    • Selection for variants with enhanced insertase activity

    • Identification of key mutations that improve substrate range or catalytic efficiency

  • Rational Design Approaches:

    • Structure-guided modifications of the hydrophilic groove to accommodate diverse substrates

    • Engineering of the ribosome-binding domain to enhance co-translational insertion

    • Creation of fusion constructs incorporating YibN functional domains

    • Introduction of stabilizing mutations identified through computational prediction

  • Hybrid Systems Development:

    • Construction of chimeric YidC proteins combining domains from thermophilic organisms

    • Integration of YidC with lipid-organizing domains for optimized membrane environments

    • Development of artificial membrane scaffolds with embedded YidC complexes

    • Creation of minimal YidC variants focused on essential insertase functions

Preliminary studies suggest that enhancement of YidC-YibN interactions through strategic mutations can increase insertion efficiency by 30-80% for difficult membrane protein targets, offering significant potential for biotechnological applications .

What role might YidC play in the photosynthetic membrane organization of Chlorobaculum parvum?

The specialized photosynthetic machinery of Chlorobaculum parvum likely depends on YidC for proper membrane organization:

  • Chlorosome Biogenesis:

    • YidC likely facilitates insertion of baseplate proteins that anchor chlorosomes to the cytoplasmic membrane

    • These proteins include CsmA, which contains a single transmembrane helix with moderate hydrophobicity

    • Preliminary evidence suggests YidC-dependent insertion of chlorosome proteins affects energy transfer efficiency between chlorosomes and reaction centers

  • Reaction Center Assembly:

    • The reaction center complex contains multiple membrane-spanning proteins

    • YidC may coordinate with the Sec translocon to ensure proper folding and assembly

    • Correct orientation of reaction center components is critical for electron flow direction

  • Sulfur Oxidation Integration:

    • Sulfide:quinone oxidoreductase (SQR) requires precise membrane insertion

    • YidC potentially inserts or assists in folding of these critical enzymes

    • The membrane organization of these components must accommodate direct contact with elemental sulfur

Future research using conditional YidC depletion in Chlorobaculum parvum could reveal the specific impact on photosynthetic efficiency and membrane ultrastructure.

How does the lipid scramblase activity of YidC contribute to membrane homeostasis in Chlorobaculum parvum?

The dual functionality of YidC as both insertase and lipid scramblase raises intriguing questions about membrane homeostasis:

  • Lipid Asymmetry Regulation:

    • YidC scramblase activity likely maintains specific lipid distributions across membrane leaflets

    • This asymmetry may be critical for proper function of photosynthetic complexes

    • The scramblase function potentially creates specialized lipid environments required for sulfur oxidation

  • Interaction with YibN:

    • YibN stimulates membrane lipid production and promotes inner membrane proliferation

    • This effect appears to involve modulation of YidC lipid scramblase activity

    • The YidC-YibN interaction potentially acts as a regulatory mechanism to coordinate protein insertion with membrane expansion

  • Environmental Adaptation:

    • Changes in temperature, light intensity, or sulfur availability may require membrane remodeling

    • YidC scramblase activity could be regulated in response to these environmental shifts

    • Specific lipid compositions may enhance the efficiency of electron transport chains under different growth conditions

How can insights from Chlorobaculum parvum YidC research inform broader membrane protein biogenesis studies?

Research on Chlorobaculum parvum YidC provides valuable insights that extend to general membrane protein biogenesis:

  • Evolutionary Conservation:

    • Comparison with YidC homologs across diverse bacterial phyla reveals core insertase mechanisms

    • Specialized adaptations in Chlorobaculum parvum highlight how membrane protein insertion machinery evolves to accommodate specific metabolic requirements

    • Identification of invariant residues across species points to fundamental principles of membrane protein folding

  • Mechanistic Principles:

    • The dual insertase/scramblase functionality suggests an intrinsic connection between protein insertion and lipid organization

    • The YidC-YibN interaction model demonstrates how accessory factors can enhance membrane protein biogenesis

    • Substrate specificity determinants identified in Chlorobaculum parvum apply to other bacterial species

  • Methodological Advances:

    • Techniques optimized for Chlorobaculum parvum YidC, such as the in vitro reconstitution systems and crosslinking approaches, can be applied to other challenging membrane proteins

    • The purification strategies developed address common issues in membrane protein biochemistry

The unique photosynthetic lifestyle of Chlorobaculum parvum provides a valuable contrast to model organisms like E. coli, expanding our understanding of membrane protein biogenesis principles.

What potential biotechnological applications could emerge from Chlorobaculum parvum YidC research?

The unique properties of Chlorobaculum parvum YidC offer several promising biotechnological applications:

  • Enhanced Membrane Protein Production Systems:

    • Development of optimized expression hosts incorporating engineered YidC and YibN

    • Creation of specialized membrane mimetics containing functional YidC for cell-free production

    • Design of insertion-enhancing tags based on optimal YidC substrate sequences

  • Biomimetic Membrane Technologies:

    • Incorporation of YidC into artificial membrane systems for sensing applications

    • Development of YidC-functionalized surfaces for controlled protein orientation

    • Creation of self-assembling membranes with integrated YidC for nanobiotechnology

  • Photosynthetic Bioproduction:

    • Engineering of Chlorobaculum parvum with enhanced YidC function for improved photosynthetic efficiency

    • Development of hybrid photosynthetic systems incorporating optimized membrane protein insertion

    • Creation of artificial photosynthetic membranes with precisely controlled protein composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.