Recombinant Chlorobaculum parvum NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in Chlorobaculum parvum?

NADH-quinone oxidoreductase subunit K (nuoK) is a protein component of Complex I in the electron transport chain. In Chlorobaculum parvum, it serves as part of the NADH dehydrogenase I complex (NDH-1), which catalyzes the transfer of electrons from NADH to quinones with an enzyme classification number of EC 1.6.99.5. The protein is encoded by the nuoK gene (locus tag: Cpar_1301) and consists of 105 amino acids. The protein is highly hydrophobic and contains multiple transmembrane domains that anchor it within the membrane, where it participates in proton translocation coupled to electron transfer .

How does nuoK relate to other subunits in the NADH-quinone oxidoreductase complex?

NuoK is one of approximately 14 subunits that make up the NADH-quinone oxidoreductase (Complex I) in bacteria. It interacts closely with other membrane-embedded subunits, particularly those involved in proton translocation. Research has shown that the NuoK subunit has homologous proteins in other membrane complexes, including the Mrp complex . This homology suggests evolutionary conservation of certain structural features between different ion-translocating membrane complexes. In the functional complex, nuoK is positioned in the membrane domain and works in concert with other subunits to couple electron transfer to proton translocation across the membrane, contributing to the generation of the proton motive force used for ATP synthesis .

What are the optimal storage conditions for recombinant Chlorobaculum parvum nuoK protein?

For optimal stability and activity retention of recombinant Chlorobaculum parvum nuoK protein, the following storage protocol is recommended:

Short-term storage (up to one week):

• Store working aliquots at 4°C

Long-term storage:

• Store at -20°C for regular use

• For extended preservation, store at -80°C

• Use 50% glycerol in Tris-based buffer for storage

Important precautions:

• Avoid repeated freeze-thaw cycles as they significantly decrease protein stability and activity

• Prepare small working aliquots to minimize freeze-thaw events

• Allow frozen protein to thaw completely at 4°C before use

• Never heat the protein to accelerate thawing

How can researchers express and purify recombinant Chlorobaculum parvum nuoK for experimental studies?

Based on established protocols for similar membrane proteins and the specific characteristics of nuoK, the following methodology is recommended:

Expression system selection:

• Use E. coli BL21(DE3) or C43(DE3) strains (specialized for membrane protein expression)

• Consider using a pET-based vector system with a C-terminal His6 tag for purification

Expression protocol:

• Transform expression plasmid into chosen E. coli strain

• Grow cultures at 37°C until OD600 reaches 0.6-0.8

• Induce protein expression with 0.5 mM IPTG

• Lower temperature to 16-18°C for overnight expression to reduce inclusion body formation

Purification strategy:

• Harvest cells and resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl

• Disrupt cells by sonication or French press

• Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

• Solubilize membrane proteins with 1% n-dodecyl-β-D-maltoside (DDM) or similar detergent

• Perform Ni-NTA affinity chromatography using imidazole gradient elution

• Conduct size exclusion chromatography for final purification

This protocol can be adapted based on research needs and should yield protein suitable for structural and functional studies .

What methods can be used to verify the activity of recombinant nuoK protein?

Due to the complexity of testing membrane protein subunits in isolation, multiple approaches should be employed:

In vitro reconstitution assay:

• Reconstitute purified nuoK with other Complex I subunits

• Measure NADH:ubiquinone oxidoreductase activity spectrophotometrically by monitoring NADH oxidation at 340 nm

• Calculate specific activity in nmol NADH oxidized/min/mg protein

Membrane incorporation assessment:

• Incorporate purified protein into liposomes

• Measure proton translocation using pH-sensitive fluorescent dyes

• Compare activity with wild-type controls

Complementation testing:

• Express recombinant nuoK in nuoK-deficient bacterial strains

• Measure restoration of NADH oxidase activity and growth under respiratory conditions

• Quantify complementation efficiency compared to wild-type strains

Binding studies:

• Perform pulldown assays with other Complex I subunits

• Use surface plasmon resonance to measure binding kinetics

• Verify proper protein folding using circular dichroism spectroscopy

These methods provide complementary information about both structural integrity and functional activity of the recombinant protein .

How can Chlorobaculum parvum nuoK contribute to understanding bacterial energy metabolism?

Chlorobaculum parvum nuoK provides a valuable model for investigating fundamental aspects of bacterial energy metabolism:

Comparative genomic studies:
Research using Chlorobaculum parvum nuoK can elucidate evolutionary relationships between different respiratory complexes. The nuoK subunit shares homology with components of the Mrp complex, suggesting evolutionary connections between different ion-translocating membrane protein complexes . This enables researchers to trace the evolutionary history of respiratory systems across diverse bacterial lineages.

Structural insights:
The compact nature of bacterial respiratory complexes makes them excellent models for structural studies. Investigation of nuoK's interaction with other Complex I subunits can reveal mechanisms of proton translocation that apply to more complex systems, including human mitochondrial Complex I implicated in various diseases.

Bioenergetic pathways:
Chlorobaculum parvum, with its 200 metabolic pathways and 1,062 enzymatic reactions , represents an excellent model for studying alternative energy conservation strategies in bacteria. The nuoK subunit's role in electron transport can help elucidate how bacteria adapt their respiratory chains to different environmental conditions.

What approaches can be used to study the structure-function relationship of Chlorobaculum parvum nuoK?

Site-directed mutagenesis strategy:

Structural biology approaches:

• Cryo-electron microscopy of reconstituted Complex I containing nuoK

• X-ray crystallography of nuoK in detergent micelles or lipidic cubic phases

• NMR spectroscopy of isotopically labeled protein to map dynamic regions

Computational methods:

• Molecular dynamics simulations to study conformational changes during catalysis

• Quantum mechanics/molecular mechanics (QM/MM) calculations to model electron and proton transfer pathways

• Evolutionary coupling analysis to identify co-evolving residue networks

These complementary approaches provide insights into how nuoK's structure enables its function in energy transduction .

How does nuoK from Chlorobaculum parvum compare with homologous proteins in other bacterial species?

Sequence conservation analysis:

Functional divergence:
While the fundamental role in proton translocation is conserved, species-specific adaptations exist. For example, the nuoK homolog in C. tepidum functions in a complex that can interact with sulfide:quinone oxidoreductase systems, reflecting adaptation to sulfide-based energy metabolism in green sulfur bacteria .

What are common difficulties in working with recombinant nuoK and how can they be addressed?

Challenge: Low expression levels

• Solution: Optimize codon usage for expression host, use specialized strains for membrane proteins (C43, C41), or try different fusion partners (MBP, SUMO) to enhance solubility.

• Technical approach: Implement auto-induction media and lower expression temperatures (16-18°C) to improve folding.

Challenge: Protein aggregation during purification

• Solution: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations to identify optimal solubilization conditions.

• Technical approach: Add glycerol (10-15%) and specific lipids (cardiolipin, phosphatidylglycerol) to stabilize the protein in solution.

Challenge: Loss of activity during purification

• Solution: Reduce purification steps and time, maintain consistent cold temperature throughout.

• Technical approach: Include selective antioxidants and protease inhibitors in buffers to prevent oxidative damage and proteolytic degradation.

Challenge: Difficulty in functional reconstitution

• Solution: Co-express with interacting subunits or purify the entire complex rather than individual subunits.

• Technical approach: Use gentle reconstitution methods with gradual detergent removal via biobeads or dialysis.

These approaches can significantly improve the success rate of experiments involving nuoK protein .

How can researchers distinguish between functional and non-functional forms of recombinant nuoK?

Biophysical characterization methods:

• Circular dichroism (CD) spectroscopy to verify secondary structure content and proper folding

• Fluorescence spectroscopy to assess tertiary structure integrity

• Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) to verify monodispersity and oligomeric state

Functional verification:

• Reconstitution into proteoliposomes and measurement of proton translocation activity

• Co-immunoprecipitation with known interacting subunits to verify binding capability

• Electron paramagnetic resonance (EPR) spectroscopy to assess proper interaction with electron transfer components

Comparison table of functional verification methods:

These complementary approaches provide a comprehensive assessment of both structural integrity and functional capacity .

How is research on Chlorobaculum parvum nuoK contributing to our understanding of bacterial bioenergetics?

Recent research on Chlorobaculum parvum nuoK is advancing our understanding of bacterial bioenergetics in several key directions:

Evolutionary insights:
Studies of nuoK homology relationships are revealing unexpected evolutionary connections between different ion-transporting membrane complexes. The discovery that nuoK has homologous proteins in the Mrp complex suggests common ancestry between respiratory complexes and ion antiporters, providing new perspectives on the evolution of bioenergetic systems.

Structural biology advances:
High-resolution structural studies of nuoK and related subunits are illuminating the molecular mechanisms of proton translocation. By mapping the precise arrangement of transmembrane helices and identifying critical amino acid residues, researchers are developing detailed models of how electron transfer is coupled to proton movement across the membrane.

Integration with sulfide metabolism:
In green sulfur bacteria like Chlorobaculum, research is uncovering connections between Complex I components and sulfide:quinone oxidoreductase (SQR) systems. Studies in the related Chlorobaculum tepidum have demonstrated interactions between respiratory complexes and sulfide oxidation pathways , suggesting integration of different energy conservation mechanisms in these specialized bacteria.

Ecological adaptations:
Research on nuoK variants across different bacterial species is revealing how energy transduction mechanisms adapt to specific ecological niches, from extreme environments to host-associated habitats. The retention of nuoK across diverse bacterial lineages underscores its fundamental importance in bioenergetic processes .

What emerging techniques show promise for studying the structure and function of nuoK and similar membrane proteins?

Single-particle cryo-electron microscopy (cryo-EM):
Recent advances in cryo-EM now enable determination of membrane protein structures at near-atomic resolution without the need for crystallization. This technique is particularly valuable for studying nuoK within the context of the entire respiratory complex, revealing dynamic interactions between subunits.

Native mass spectrometry:
Emerging methods in native mass spectrometry allow analysis of intact membrane protein complexes with bound lipids and cofactors. This provides insights into the composition and stoichiometry of functional complexes containing nuoK under near-native conditions.

In-cell NMR spectroscopy:
This technique enables structural and dynamic studies of nuoK directly within living cells, providing information about in vivo conformational states and interactions without artificial isolation.

Comparison of emerging methodologies:

These emerging methods are overcoming traditional barriers to membrane protein research, enabling unprecedented insights into nuoK structure and function .

How might research on bacterial nuoK inform studies of mitochondrial Complex I in eukaryotes?

Bacterial nuoK research provides valuable insights that can be translated to understanding mitochondrial Complex I:

Evolutionary conservation:
The bacterial nuoK subunit has homologs in mitochondrial Complex I (including the ND4L subunit), reflecting their common evolutionary origin. Research on the simpler bacterial systems can reveal fundamental mechanisms that apply to the more complex eukaryotic complexes.

Disease mechanism insights:
Multiple human mitochondrial diseases are associated with mutations in Complex I subunits. Understanding the structure-function relationships in bacterial homologs like nuoK can help interpret the molecular consequences of disease-causing mutations in human patients.

Drug development applications:
Bacterial systems provide simplified models for testing compounds that modulate Complex I activity. Insights from nuoK research could inform the development of therapies targeting mitochondrial dysfunction in conditions ranging from neurodegenerative diseases to cancer.

Functional conservation table:

By leveraging the relative simplicity and experimental accessibility of bacterial systems, nuoK research serves as an important model for understanding the more complex eukaryotic respiratory complexes involved in human health and disease .

How does nuoK-containing Complex I interact with sulfide:quinone oxidoreductase systems in green sulfur bacteria?

In green sulfur bacteria like Chlorobaculum species, the interaction between nuoK-containing Complex I and sulfide:quinone oxidoreductase (SQR) systems represents a specialized metabolic adaptation:

Electron transfer pathway:
Studies in Chlorobaculum tepidum have demonstrated that electrons derived from sulfide oxidation by SQR can enter the electron transport chain via quinones that then interact with Complex I. The nuoK subunit, as part of the membrane domain of Complex I, likely participates in quinone binding and proton translocation coupled to this electron transfer .

Co-regulation mechanisms:
Research has shown that in Chlorobaculum tepidum, certain SQR homologs (CT1087) are expressed only when cells are actively oxidizing sulfide, suggesting coordinated regulation with respiratory complexes. This indicates a functional integration between sulfide metabolism and respiratory electron transport systems that likely involves the nuoK-containing Complex I .

Metabolic flexibility:
The ability to couple sulfide oxidation to the respiratory chain provides metabolic flexibility, allowing these bacteria to utilize various electron donors. The nuoK subunit's role in proton translocation makes it an integral part of the energy conservation mechanism regardless of the initial electron donor (NADH or sulfide via SQR) .

Experimental evidence table:

This metabolic integration represents an adaptation to the ecological niche of green sulfur bacteria, which often inhabit sulfide-rich anaerobic environments .

What methodologies are most effective for studying the integration of nuoK function with sulfur metabolism?

Genetic approaches:

• Construction of nuoK deletion mutants in Chlorobaculum parvum using methods similar to those employed for C. tepidum

• Creation of reporter fusions (e.g., nuoK promoter-GFP) to monitor expression under different sulfur conditions

• Generation of strains with modified nuoK (e.g., His-tagged versions) for in vivo interaction studies

Biochemical methods:

• Isolation of intact membrane complexes under native conditions to preserve interactions

• Respiratory complex activity assays using different electron donors (NADH vs. sulfide)

• Reconstitution of purified nuoK with SQR proteins in proteoliposomes to study direct interactions

Systems biology approaches:

• Transcriptome analysis comparing expression profiles under different sulfur conditions

• Metabolomic profiling to track sulfur compounds and energy intermediates

• Flux balance analysis to model electron flow through different pathways

Methodological comparison:

The most comprehensive understanding comes from combining these approaches, starting with systems-level analyses to generate hypotheses, followed by targeted biochemical and genetic experiments to test specific mechanisms .

What structural features of nuoK are critical for its function in the NADH-quinone oxidoreductase complex?

Based on comparative analyses and studies of related proteins, several structural features of nuoK are critical for its function:

Transmembrane topology:
NuoK contains three predicted transmembrane helices that anchor it within the membrane domain of Complex I. The precise orientation of these helices creates channels for proton translocation across the membrane. The amino acid sequence "MEQFLSIGVNHFLTISVLLFSLGMFAVMTRKNAIVILMGVELILNAANINFLTFSKYNGG MEGVMFSLFVIVLAAAEAAVALAIVINIFKTFKTVDVSSVDTMKE" contains hydrophobic stretches consistent with this prediction .

Conserved charged residues:
Key charged amino acids (particularly lysine, arginine, glutamate, and aspartate residues) within the transmembrane helices likely participate directly in proton transfer. These residues can form a relay system that facilitates proton movement across the otherwise hydrophobic membrane environment.

Quinone interaction regions:
Specific regions of nuoK may contribute to quinone binding sites at the interface with other subunits. These regions would contain amino acids capable of forming hydrogen bonds or π-stacking interactions with the quinone ring structure.

Structural motifs table:

These structural features work together to position nuoK correctly within the complex and enable its participation in the proton translocation mechanism coupled to electron transfer .

How can structural biology techniques be optimized for studying nuoK in isolation and within the complete complex?

Optimization strategies for structural studies of nuoK:

X-ray crystallography approaches:

• Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL) to provide crystal contacts

• Lipidic cubic phase crystallization to maintain membrane protein in native-like environment

• Antibody fragment (Fab/nanobody) co-crystallization to stabilize specific conformations

• Detergent screening matrix to identify conditions that maintain stability while promoting crystal formation

Cryo-EM optimization:

• Reconstitution in nanodiscs or amphipols to mimic native membrane environment

• Use of modified Volta phase plates to enhance contrast for smaller complexes

• Application of focused refinement techniques to resolve the nuoK region within the larger complex

• Implementation of time-resolved cryo-EM to capture different functional states

NMR approaches for isolated nuoK:

• Selective isotope labeling of specific amino acids to reduce spectral complexity

• Solid-state NMR in lipid bilayers to study the protein in a membrane environment

• Paramagnetic relaxation enhancement to map distances between specific residues

• TROSY-based experiments optimized for membrane proteins

Comparative method assessment:

An integrative structural biology approach combining multiple techniques offers the most comprehensive understanding of nuoK structure and dynamics in both isolated and complex forms .

What does comparative genomics reveal about the evolution of nuoK in different bacterial lineages?

Comparative genomic analysis reveals several important aspects of nuoK evolution:

Conservation patterns:
The nuoK gene is highly conserved across diverse bacterial phyla, indicating its essential role in energy metabolism. Chlorobaculum parvum nuoK shares significant sequence similarity with homologs in both closely related green sulfur bacteria and more distantly related bacterial groups. This conservation extends to the key functional regions, particularly the transmembrane domains and charged residues involved in proton translocation .

Evolutionary relationships with other complexes:
One of the most significant findings is that nuoK has homologous proteins in the Mrp complex , which functions as a Na+/H+ antiporter in many bacteria. This homology suggests that Complex I and the Mrp complex share an evolutionary history, potentially evolving from a common ancestral ion-translocating membrane protein. This connection provides insights into the evolutionary origins of respiratory complexes.

Genomic context:
In most bacteria, including Chlorobaculum parvum, the nuoK gene is located within an operon containing other Complex I subunit genes. This genomic organization is largely conserved, though some bacteria show rearrangements. In Chlorobaculum parvum, the nuoK gene (Cpar_1301) is part of the nuo operon, reflecting the coordinated expression and assembly of Complex I subunits .

Selective pressure analysis:
Pattern of sequence conservation indicates that certain regions of nuoK experience stronger selective pressure, particularly those involved in proton translocation and subunit interactions. Other regions, especially surface-exposed loops, show greater sequence variability across species, suggesting adaptation to specific environments or interactions with species-specific partners.

Evolutionary classification:

This evolutionary perspective highlights nuoK's ancient origin and fundamental importance in bacterial bioenergetics .

What are promising future research directions for understanding nuoK function in bacterial bioenergetics?

Several promising research directions could advance our understanding of nuoK function:

High-resolution structural studies:
Obtaining atomic-resolution structures of nuoK within the complete Complex I in different functional states would provide crucial insights into the conformational changes associated with proton translocation. This could be achieved through advances in cryo-EM or crystallographic techniques, potentially revealing how electron transfer is mechanistically coupled to proton pumping.

Real-time dynamics:
Developing methods to monitor conformational changes in nuoK during catalysis would transform our understanding of its function. Time-resolved spectroscopy, single-molecule FRET, or advanced EPR techniques could capture the dynamic behavior of nuoK during the catalytic cycle.

Integration with synthetic biology:
Engineering minimal respiratory systems containing nuoK and essential partner subunits could create simplified models for mechanistic studies. This could include creating chimeric proteins that combine domains from different species or even designing novel nuoK variants with enhanced properties.

Systems-level understanding:
Exploring how nuoK-containing complexes integrate with other metabolic pathways, particularly in bacteria with versatile energy metabolism like Chlorobaculum parvum, would provide insights into the broader role of respiratory complexes in bacterial adaptation. This could involve studying how nuoK expression and activity are regulated in response to changing environmental conditions .

Research priority matrix:

These research directions would collectively advance our fundamental understanding of bioenergetic processes while potentially informing applications in synthetic biology and antimicrobial development.

How might research on bacterial nuoK contribute to biotechnological applications?

Research on bacterial nuoK has several potential biotechnological applications:

Bioenergy production:
Understanding the mechanism of energy transduction in nuoK could inform the design of more efficient microbial fuel cells or bioelectrochemical systems. By optimizing proton translocation and electron transfer, engineered bacteria containing modified nuoK variants could potentially achieve higher power output or improved substrate utilization.

Biosensors for environmental monitoring:
The sulfide oxidation capacity of green sulfur bacteria like Chlorobaculum parvum could be harnessed to develop biosensors for detecting sulfide in environmental samples. By coupling nuoK function to reporter systems, bacteria could be engineered to produce measurable signals in response to specific electron donors.

Biohydrogen production:
Modified respiratory complexes containing engineered nuoK could potentially redirect electron flow toward hydrogen production under specific conditions. This could contribute to developing more efficient biohydrogen production systems as sustainable energy sources.

Protein engineering platforms:
The structural insights gained from nuoK research could inform the design of novel membrane proteins with desired functions, such as selective ion transporters or environment-responsive channels. The relatively simple structure of nuoK makes it an attractive scaffold for protein engineering efforts.

Antimicrobial target development:
The essential role of nuoK in bacterial energy metabolism makes it a potential target for novel antimicrobials. Structural and functional studies could identify specific features that differ between bacterial and human homologs, enabling the design of selective inhibitors.

Application assessment matrix:

These applications highlight how fundamental research on bacterial proteins like nuoK can lead to diverse biotechnological innovations .