Recombinant Chlorobaculum parvum Photosynthetic reaction center cytochrome c-551 (pscC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pscC; cycA; Cpar_0549; Photosynthetic reaction center cytochrome c-551; Cytochrome c551
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
pscC
Target Protein Sequence
MDNKSNGKLIALAIGGAVLMGTLFFLVSFLTGYSPAPNHSAILTPLRSFMGWFLLIFCAS LIIMGLGKMSGAISDKWFLSFPLSIFVIVMVMFFSLRFYWEKGRTTTVDGKYIRSVEQLN DFLNKPAATSDLPPVPADFDFAAAEKLTDAKCNKCHTLGSVADLFRTKYKKTGQVKLIVK RMQGFPGANISDDEVIEIGTWLQEKF
Uniprot No.

Target Background

Function

Monoheme cytochrome serving as the immediate electron donor to P840 within the photosynthetic reaction center complex.

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c-551 (pscC) and what role does it play in photosynthesis?

Cytochrome c-551, also referred to as cytochrome cz (cyt cz) or PscC, is a membrane-bound monoheme cytochrome that serves as the immediate electron donor to P840 in the photosynthetic reaction center of green sulfur bacteria including Chlorobaculum parvum (formerly known as Chlorobium vibrioforme). This protein mediates electron transfer primarily from menaquinole/cytochrome c oxidoreductase to the special pair (P840) of the reaction center . Unlike other photosynthetic organisms that utilize soluble electron carriers between cytochrome complexes and reaction centers, green sulfur bacteria employ this membrane-anchored cytochrome for the corresponding electron transfer process. This represents a unique adaptation in their photosynthetic apparatus which functions under strict anaerobic conditions .

How does the structure of cytochrome c-551 relate to its electron transfer function?

The structure of cytochrome c-551 is specifically adapted for its electron transfer role through several key features:

  • The N-terminal structure supports a "swinging mechanism" where the periplasmic domain can move between its electron transfer partners .

  • The heme group has a relatively large exposed surface area, which facilitates electron transfer interactions .

  • The periplasmic domain appears to function as a monomer, with each of the two cyt cz subunits in the reaction center complex acting independently as electron donors to P840 .

  • The orientation of the axial ligands relative to the heme plane differs from that in other c-type cytochromes, potentially affecting the redox properties of the heme iron .

  • A unique arrangement of water molecules near the heme propionate groups creates a distinctive hydrogen-bonding network that may modulate the redox potential .

What distinguishes cytochrome c-551 from other c-type cytochromes in photosynthetic organisms?

Several features distinguish cytochrome c-551 from other c-type cytochromes:

  • Membrane anchoring: Unlike soluble cytochromes (such as cytochrome c6 in cyanobacteria), cyt cz has three membrane-spanning regions. This differs from cytochrome cy in purple bacteria (which has a single membrane-spanning domain) and cytochrome c553 in heliobacteria (which attaches to the membrane via a fatty acid chain) .

  • Lower redox potential: Cytochrome c-551 exhibits a lower midpoint redox potential (approximately +190 mV) compared to cytochrome c551 (~+270 mV) or c6 (~+370 mV) .

  • Heme environment: The heme in cytochrome c-551 has a larger exposed surface area and unique water molecule positions around the heme propionate groups compared to other c-type cytochromes .

  • Strict anaerobic adaptation: The protein's structure, with significant heme exposure, may make it particularly sensitive to oxidative damage, aligning with the strict anaerobic lifestyle of green sulfur bacteria .

What expression systems have been successful for recombinant cytochrome c-551 production?

The C-terminal functional domain of cytochrome c-551 (C-cyt cz) has been successfully expressed in Escherichia coli strain C41 using the cytochrome c maturation (ccm) gene clusters . This system enables the proper incorporation of the heme group and formation of the thioether bonds between the heme vinyl groups and the cysteine residues of the CXXCH motif. The expression system described in the literature involves extracting the recombinant protein from the periplasmic fraction, indicating successful targeting to this compartment where the cytochrome c maturation machinery operates . This approach overcomes one of the major challenges in producing recombinant c-type cytochromes, which is ensuring proper covalent attachment of the heme group.

How can researchers verify the integrity and functionality of recombinant cytochrome c-551?

Multiple complementary approaches can verify the integrity and functionality of recombinant cytochrome c-551:

  • UV-visible absorption spectroscopy: Properly folded cytochrome c-551 with correctly incorporated heme shows characteristic absorption peaks, particularly the α-band at 551 nm in the reduced state .

  • SDS-PAGE analysis: This confirms the purity and correct molecular weight of the purified protein .

  • Redox titrations: Measuring the midpoint potential using techniques such as potentiometric titration with appropriate redox mediators (2,3,5,6-tetramethyl-1,4-phenylenediamine, phenazine ethosulfate, phenazine methosulfate, and 2-methyl-1,4-naphthoquinone) can verify proper heme incorporation and protein folding . The midpoint potential of properly folded C-cyt cz should be approximately +190 mV .

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): This technique confirms the monomeric state of the protein in solution and provides information about its hydrodynamic properties .

Spectroscopic and electrochemical analyses of recombinant C-cyt cz have demonstrated properties very similar to those of cyt cz in purified reaction centers and native membranes, confirming that the E. coli-expressed protein has the same protein fold and heme coordination as in native cyt cz .

What purification strategy yields high-purity cytochrome c-551?

While the search results don't provide complete details on the purification protocol, they indicate that C-cyt cz was isolated from the periplasmic fraction of E. coli cells expressing the protein . Based on standard approaches for c-type cytochromes, an effective purification strategy would likely include:

  • Selective extraction of the periplasmic fraction using osmotic shock or mild detergent treatment.

  • Initial purification by ion-exchange chromatography, taking advantage of the charged surface properties of the protein.

  • Further purification using size-exclusion chromatography to separate monomeric protein from any aggregates.

  • Quality assessment by SDS-PAGE and UV-visible spectroscopy to confirm purity and proper heme incorporation .

The final purified protein should be stored in an appropriate buffer with consideration for its oxygen sensitivity, potentially with the addition of glycerol or other stabilizing agents as seen in commercial preparations that use Tris-based buffer with 50% glycerol .

What spectroscopic techniques are most informative for studying cytochrome c-551?

Several spectroscopic techniques provide valuable information about different aspects of cytochrome c-551:

  • UV-visible absorption spectroscopy: The most basic technique for monitoring the redox state of the heme through the characteristic absorption bands, particularly the α-band at 551 nm. This can be used to follow oxidation-reduction reactions and determine the concentration of functional protein .

  • NMR spectroscopy: 1H NMR has revealed unusually large paramagnetic shifts in oxidized C-cyt cz, which correlate with the orientation of the axial ligands relative to the heme plane. This technique provides insights into the electronic structure of the heme and its environment .

  • Flash-induced absorption spectroscopy: This technique has been used to demonstrate that two copies of cyt cz bind to one reaction center in stable complexes isolated from C. tepidum membranes, and to study the electron transfer kinetics from cyt cz to P840 .

  • Circular dichroism: While not explicitly mentioned in the search results, this technique would be valuable for assessing the secondary structure content and folding of the protein.

  • Resonance Raman spectroscopy: This would provide information about the heme environment and coordination state.

How can the electron transfer function of cytochrome c-551 be experimentally verified?

The electron transfer function of cytochrome c-551 can be experimentally verified through several approaches:

  • Flash-induced absorption spectroscopy: This technique directly measures the kinetics of light-induced electron transfer from cyt cz to P840. It has revealed that the electron transfer exhibits strong viscosity dependence, supporting the proposal that the heme-binding domain fluctuates between its electron transfer partners .

  • Redox titrations: Determining the midpoint potential of the heme group provides information about its ability to participate in biological electron transfer reactions. This can be done through potentiometric titrations monitoring the absorption changes at 551 nm as the protein is oxidized or reduced .

  • Stopped-flow spectroscopy: This technique can measure the kinetics of electron transfer between cyt cz and its partners in solution.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, surface plasmon resonance, or isothermal titration calorimetry can identify and characterize interactions between cyt cz and its electron transfer partners.

  • Reconstitution experiments: Incorporating purified cyt cz into membrane systems or with purified reaction centers can demonstrate its ability to mediate electron transfer in a more native-like environment.

What structural analysis techniques provide insights into cytochrome c-551 dynamics?

Several structural analysis techniques can provide insights into the conformational dynamics of cytochrome c-551:

The crystal structure analysis of C-cyt cz has provided evidence supporting the swinging mechanism previously proposed for electron transfer, with the N-terminal structure particularly implicated in this mobility .

How does the unique structure of cytochrome c-551 influence its redox properties?

The structure of cytochrome c-551 influences its redox properties through several unique features:

  • Axial ligand orientation: The orientation of the axial ligands (histidine and methionine) with respect to the heme plane differs from that in other c-type cytochromes. This orientation affects the electron distribution of the heme iron and can influence the redox state and electron transfer properties .

  • Heme exposure: A large area of the heme group is exposed to the surface in C-cyt cz. For cytochrome subunits in general, hemes exposed to solvent typically have lower redox potentials than those buried in the hydrophobic interior. This correlates with the lower midpoint potential of C-cyt cz (+190 mV) compared to other c-type cytochromes .

  • Water molecule in the heme pocket: A water molecule is bound in the pocket formed by the tetrapyrrole ring and the CXXCH motif. This water could influence the electron distribution in the tetrapyrrole ring and affect the loop structure around the CXXCH motif by modifying the hydrogen-bonding pattern .

  • Unique arrangement of water molecules: C-cyt cz has water molecules near the heme propionates at positions different from the conserved water molecule in mitochondrial cytochrome c. These differences in the hydrogen-bonding network involving the heme propionate groups likely contribute to the distinct redox properties of C-cyt cz .

  • Conformational mobility: The conformational mobility of the CXXCH motif has been reported to modulate heme redox potential in other cytochromes, suggesting that the specific structural arrangements in C-cyt cz could serve a regulatory function .

What insights have been gained from comparative analysis of cytochromes across different green sulfur bacteria?

Comparative analysis of cytochromes across different green sulfur bacteria has revealed:

  • Conservation of key features: Despite sequence variations, the hydrophobic and hydrophilic surface properties important for function are conserved in cyt cz homologues across green sulfur bacteria .

  • Evolutionary relationships: Green sulfur bacterial reaction centers (including their cytochrome components) have been compared with those of other photosynthetic organisms. While the core reaction center protein PscA shows similarities to PsaA/PsaB of photosystem I, suggesting evolution from a common ancestor, the PS-I reaction center does not possess a c-type cytochrome subunit like PscC in green sulfur bacteria .

  • Structural diversity in membrane anchoring: Membrane-anchored cytochromes in different photosynthetic bacteria (green sulfur bacteria, purple bacteria, and heliobacteria) show very low similarity in their amino acid sequences and have different arrangements in their membrane-anchoring domains, making their evolutionary relationships unclear .

  • Functional adaptations: The structures of these cytochromes reflect adaptations to their specific roles and environments, such as the strict anaerobic lifestyle of green sulfur bacteria. The exposure of a large area of the heme group to the surface may make C-cyt cz particularly sensitive to oxidation, which would be problematic in aerobic environments but manageable in the strict anaerobic growth conditions of green sulfur bacteria .

How can computational approaches model electron transfer pathways involving cytochrome c-551?

While the search results don't explicitly discuss computational modeling, several approaches would be valuable for studying the electron transfer pathways involving cytochrome c-551:

  • Molecular docking simulations: These could predict the binding interfaces between C-cyt cz and its electron transfer partners, such as the reaction center P840 and menaquinole/cytochrome c oxidoreductase.

  • Electron tunneling pathway analysis: Based on the crystal structure, computational methods could identify potential electron tunneling pathways between the heme of C-cyt cz and its partners.

  • Molecular dynamics simulations: These would model the proposed swinging motion of the periplasmic domain and how it might facilitate electron transfer between different partners.

  • Quantum mechanical/molecular mechanical (QM/MM) calculations: These could provide insights into the electronic structure of the heme and how it changes during electron transfer.

  • Brownian dynamics simulations: These could model the diffusion-controlled aspects of the protein-protein interactions involved in electron transfer.

The crystal structure analysis has already provided some insights relevant to computational modeling, such as identifying a hydrophobic patch on the surface of C-cyt cz that likely represents the interaction interface with its electron transfer partners .

What precautions are necessary when working with oxygen-sensitive cytochrome c-551?

Several precautions are necessary when working with oxygen-sensitive cytochrome c-551:

  • Anaerobic techniques: Redox titrations should be performed under a continuous flow of inert gas (such as argon) to maintain anaerobic conditions .

  • Appropriate storage: Commercial preparations of the protein are stored in Tris-based buffer with 50% glycerol, likely to maintain stability and prevent oxidative damage . For extended storage, temperatures of -20°C or -80°C are recommended, with repeated freezing and thawing discouraged .

  • Oxygen exposure awareness: The large exposed area of the heme group makes it particularly susceptible to oxidation by oxygen. The strict anaerobic growth condition of green sulfur bacteria enables their utilization of cyt cz for electron transfer, but in laboratory settings, this sensitivity must be managed carefully .

  • Reduced handling: Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles , but should be handled to minimize oxygen exposure.

  • Spectroscopic monitoring: Regular monitoring of the UV-visible spectrum can verify that the protein remains in its functional state and has not been damaged by oxidation.

How can researchers accurately determine the redox potential of cytochrome c-551?

Accurate determination of the redox potential of cytochrome c-551 can be achieved through:

  • Potentiometric titrations: These should be performed under anaerobic conditions (continuous flow of argon gas) using an ORP electrode and a reference Ag/AgCl2 electrode .

  • Appropriate buffer conditions: Measurements in the literature were performed in 100 mM potassium phosphate buffer, pH 7.0 .

  • Suitable redox mediators: A mixture of mediators covering the appropriate potential range should be used, such as 10 μM each of 2,3,5,6-tetramethyl-1,4-phenylenediamine, phenazine ethosulfate, phenazine methosulfate, and 2-methyl-1,4-naphthoquinone .

  • Spectroscopic monitoring: Changes in the absorption of the cytochrome α-band at 551 nm should be measured as a function of the applied potential .

  • Data analysis: The resulting data should be fitted to the one-component Nernst equation using appropriate software to determine the midpoint potential .

Using this methodology, the midpoint potential (Em,7) of C-cyt cz has been determined to be approximately +190 mV, which is lower than that of other c-type cytochromes such as cytochrome c551 (+270 mV) or c6 (+370 mV) .

What controls are essential in experiments investigating electron transfer function?

Essential controls for experiments investigating the electron transfer function of cytochrome c-551 include:

  • Spectroscopic verification: Confirming that the recombinant protein has properties similar to those of the native protein in terms of UV-visible spectrum and redox potential .

  • Protein integrity verification: Using techniques such as SDS-PAGE and SEC-MALS to confirm the purity, molecular weight, and monomeric state of the protein .

  • Negative controls: Including experiments with denatured or chemically modified protein to demonstrate the specificity of the electron transfer reactions.

  • Comparisons with related cytochromes: Including control experiments with other c-type cytochromes to highlight the unique properties of cytochrome c-551.

  • Viscosity dependence: In kinetic studies, varying the viscosity of the medium can provide insights into the proposed swinging mechanism for electron transfer, as demonstrated by the strong viscosity dependence observed in flash-induced electron transfer from cyt cz to P840 .

  • Partner specificity: Testing electron transfer to/from various potential partners to confirm the specificity of the physiological electron transfer pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.