Recombinant Chlorobaculum parvum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

UppP is indispensable for recycling UPP, a bottleneck in cell wall precursor transport. Key findings include:

  • Synthetic Lethality: In B. subtilis, UppP and BcrC form a synthetic lethal pair; deleting both halts growth due to Und-P depletion .

  • Bacitracin Resistance: UppP competes with bacitracin for UPP binding, conferring low-level resistance in Enterococcus faecalis .

  • Sporulation Link: B. subtilis UppP depletion disrupts sporulation, causing defective spore cortex formation .

Expression Systems

  • E. coli: Produces soluble, active enzyme with N-terminal His-tags for purification .

  • Yeast: Alternative system for high-yield expression, though less commonly used .

Research Applications

  • ELISA Development: Commercial kits utilize recombinant UppP for antibody detection .

  • Antibiotic Studies: Used to screen inhibitors targeting UPP metabolism, such as bacitracin analogs .

  • Stress Response Analysis: Depleting UppP activates σM-dependent cell envelope stress pathways .

Key Research Findings

StudyKey InsightSource
CRISPRi ValidationUppP depletion causes cell elongation and lysis in B. subtilis .
Bacitracin ResistanceUppP overexpression reduces bacitracin susceptibility in E. faecalis .
Sporulation DefectsΔuppP mutants produce phase-gray spores with impaired heat resistance .

Future Directions

Current studies focus on:

  1. Structural Analysis: Resolving UppP’s membrane-binding domains to design targeted antibiotics.

  2. Stress Signaling: Elucidating UppP’s role in σM activation under cell wall stress .

  3. Enzyme Redundancy: Exploring backup phosphatases like YodM in UppP-deficient strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
uppP; Cpar_1706; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))
Target Names
uppP
Target Protein Sequence
MNLFQAIILGIVQGLTEFLPISSSAHLRIVPALAGWDDPGAAFTAIVQIGTLAAVLIYFM KDIISIVGAVVSDLLKGKPLASDESRTGWMIAAGTIPIVVFGLAFKDDIETTLRSLYWVS AALIALALVLSIAEKHTSNRARQGRRGKAISEITWLDAMIIGFAQAMALIPGSSRSGVTI TAGLFRNLDRETSARFSFLLSLPSVFAAGIYQLYKTWDVITASTDNMINIAVATVFAFIF GYLSIAFLLTYLKRHSTGIFIGYRLLLGISLIIMIGTGHLMP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of uppP in Chlorobaculum parvum?

In Chlorobaculum parvum NCIB 8327, the uppP gene is identified by the ordered locus name Cpar_1706 within the 2,289,249 bp genome . The gene is part of a genome that contains 2,157 total genes, with 2,033 protein-coding genes, 58 RNA genes, and 66 pseudogenes . Understanding the genomic context of uppP provides insights into potential co-regulation with other genes involved in cell wall biosynthesis or related metabolic pathways.

The taxonomic classification of the organism is significant for comparative genomic studies: Chlorobaculum parvum belongs to the phylum Chlorobiota (green sulfur bacteria), class Chlorobiia, order Chlorobiales, family Chlorobiaceae . This classification places it in an interesting phylogenetic position for studying the evolution of cell wall biosynthesis enzymes across bacterial lineages.

What enzymatic reaction does Chlorobaculum parvum uppP catalyze?

Chlorobaculum parvum uppP (EC 3.6.1.27) catalyzes the following reaction:

Undecaprenyl diphosphate + H₂O → Undecaprenyl phosphate + Phosphate

This dephosphorylation reaction is critical in the bacterial cell wall biosynthesis cycle . After peptidoglycan precursors are transported across the cytoplasmic membrane and incorporated into the growing cell wall, the resulting undecaprenyl pyrophosphate must be recycled back to undecaprenyl phosphate to continue the transport cycle . The uppP enzyme performs this essential recycling function, making it integral to bacterial cell wall synthesis and a potential target for antibacterial agents.

What are the optimal systems and conditions for expressing recombinant Chlorobaculum parvum uppP?

Successful expression of Chlorobaculum parvum uppP requires careful consideration of expression systems and conditions due to its membrane protein nature. The following methodological approach is recommended based on experience with similar bacterial membrane proteins:

Expression System Selection:

Expression SystemAdvantagesDisadvantagesRecommended Uses
E. coli BL21(DE3)High yield, simple protocolsPotential toxicity, inclusion bodiesInitial screening, mutant studies
E. coli C41/C43Better for toxic membrane proteinsLower yieldsWild-type uppP expression
Insect cell systemsImproved folding, eukaryotic modificationsHigher cost, complex protocolsStructural studies
Cell-free systemsAvoids toxicity issuesLower yields, expensiveDifficult constructs, rapid screening

For optimal expression, the following protocol parameters should be considered:

  • Use of an inducible promoter system (T7 or arabinose-inducible)

  • Addition of a purification tag (His6, FLAG, or Strep-tag)

  • Low temperature induction (16-25°C)

  • Extended expression time (16-24 hours)

  • Low inducer concentration (0.1-0.5 mM IPTG or 0.01-0.05% arabinose)

These conditions balance protein yield with proper folding, which is crucial for obtaining functionally active recombinant uppP enzyme .

What purification strategies maintain the structural integrity and activity of uppP?

Purification of membrane proteins like uppP requires specialized approaches to preserve native structure and enzymatic activity. A systematic purification strategy includes:

Membrane Preparation and Solubilization:

  • Cell disruption using mechanical methods (sonication, French press)

  • Membrane isolation via differential centrifugation

  • Solubilization using mild detergents

Detergent Selection Considerations:

DetergentCritical Micelle Concentration (mM)AdvantagesDisadvantages
n-Dodecyl-β-D-maltoside (DDM)0.17Widely used, mildLarge micelles
Lauryl maltose neopentyl glycol (LMNG)0.01Very mild, small micellesExpensive
Digitonin0.5Very mild, good for complexesCostly, variable purity
CHAPS8-10Compatible with functional assaysLess efficient solubilization

Chromatography Steps:

  • Affinity chromatography using the introduced tag

  • Size exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography for higher purity

For storage, the purified protein should be maintained in a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and detergent at approximately 2× critical micelle concentration . Addition of phospholipids (0.1-0.5 mg/ml) may enhance stability during storage at -80°C.

What assays can be used to measure the enzymatic activity of recombinant Chlorobaculum parvum uppP?

Several complementary approaches can be employed to measure the enzymatic activity of recombinant uppP:

Phosphate Release Detection Methods:

MethodPrincipleDetection LimitAdvantagesLimitations
Malachite GreenColorimetric detection of phosphomolybdate complex0.5-1 nmol PiSimple, inexpensiveBackground phosphate interference
EnzCheck Phosphate AssayEnzymatic coupling with MESG0.1-0.5 nmol PiHigher sensitivityMore expensive, enzyme stability
Radioactive Assay (³²P)Scintillation counting of released phosphate0.01-0.1 nmol PiHighest sensitivityRadiation hazards, specialized equipment

Substrate Consumption Monitoring:

  • HPLC-based separation and quantification of undecaprenyl pyrophosphate and undecaprenyl phosphate

  • TLC-based methods with phosphate-specific detection reagents

  • Mass spectrometry-based quantification of substrate and product

Standard Reaction Conditions Protocol:

  • Buffer: 50 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl₂, 0.1% (w/v) DDM

  • Enzyme concentration: 0.1-1 μg purified protein

  • Substrate concentration: 25-100 μM undecaprenyl pyrophosphate

  • Temperature: 30°C (optimal for Chlorobaculum parvum)

  • Time points: 0, 5, 10, 15, 30 minutes

  • Detection method: Malachite green assay for routine analysis

This multiparametric approach enables comprehensive characterization of the enzyme's kinetic properties, including determination of KM, kcat, and optimal reaction conditions.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of uppP?

Site-directed mutagenesis provides a powerful approach to elucidate the catalytic mechanism of uppP by systematically altering specific amino acid residues. Based on sequence analysis and homology with related phosphatases, a strategic mutagenesis plan should include:

Key Residues for Mutation:

  • Conserved aspartic acid residues (potential catalytic residues)

  • Histidine residues (potential roles in substrate binding or catalysis)

  • Lysine and arginine residues (potential roles in phosphate coordination)

  • Hydrophobic residues in transmembrane domains (substrate recognition)

Mutagenesis Strategy:

  • Generate a series of single-point mutants (typically alanine substitutions)

  • Express and purify each mutant under identical conditions

  • Analyze enzymatic activity using standardized assays

  • Compare kinetic parameters (KM, kcat, kcat/KM) with wild-type enzyme

Complementary Approaches:

  • Molecular dynamics simulations to predict structural changes

  • Chemical rescue experiments (adding exogenous nucleophiles)

  • pH-rate profiles to determine ionization states of catalytic residues

  • Metal ion dependence studies (replacement/removal of metal cofactors)

This systematic approach allows for the development of a detailed catalytic model by identifying residues essential for substrate binding, chemical catalysis, and product release . The resulting mechanistic insights are valuable not only for understanding uppP function but also for the rational design of inhibitors targeting this enzyme.

What methods are most suitable for determining the three-dimensional structure of Chlorobaculum parvum uppP?

Determining the three-dimensional structure of membrane proteins like uppP presents unique challenges. Multiple complementary approaches can be employed:

X-ray Crystallography Approaches:

  • Traditional vapor diffusion crystallization with detergent-solubilized protein

  • Lipidic cubic phase (LCP) crystallization, which better mimics the membrane environment

  • Co-crystallization with antibody fragments to increase hydrophilic surface area

  • Fusion protein approaches (e.g., with T4 lysozyme) to aid crystallization

Cryo-Electron Microscopy (Cryo-EM):

  • Single-particle analysis for purified protein in detergent micelles or nanodiscs

  • Subtomogram averaging for protein reconstituted in liposomes

  • Microcrystal electron diffraction (MicroED) for small 3D crystals

NMR Spectroscopy Options:

  • Solution NMR for specific domains or fragments

  • Solid-state NMR for the full-length protein in a membrane-like environment

Integrative Structural Biology Approach:
Combining multiple experimental techniques with computational modeling provides the most comprehensive structural information:

Each technique has specific sample preparation requirements and offers different advantages in terms of resolution and information content. The choice of method should be guided by the specific research questions and available resources.

What computational methods can predict the structure-function relationship of uppP in the absence of experimental structures?

In the absence of experimental structures, computational methods provide valuable insights into the structure-function relationships of uppP:

Homology Modeling:

  • Identify suitable templates from structurally characterized homologs

  • Generate sequence alignments focusing on conserved functional regions

  • Build models using software like MODELLER, SWISS-MODEL, or Rosetta

  • Refine models with energy minimization and validation

Ab Initio and Deep Learning Methods:

  • AlphaFold2 or RoseTTAFold for full-length protein structure prediction

  • Fragment-based methods for specific domains

  • Specialized membrane protein prediction tools (MEMOIR, TOPCONS)

Model Validation Approaches:

  • Ramachandran plot analysis for geometric validation

  • PROCHECK or MolProbity for stereochemical quality assessment

  • Comparison with experimental data from mutagenesis studies

  • Molecular dynamics simulations to test stability

Functional Site Prediction:

  • Conservation analysis to identify functionally important residues

  • Binding site prediction using tools like CASTp or SiteMap

  • Molecular docking of substrate to predict binding modes

  • Electrostatic surface analysis to identify potential catalytic residues

These computational approaches can guide experimental designs and provide testable hypotheses about structure-function relationships in uppP. The reliability of these predictions has significantly improved with recent advances in deep learning-based protein structure prediction methods.

How does Chlorobaculum parvum uppP compare with homologous enzymes from other bacterial species?

Comparative analysis of uppP across bacterial species provides insights into conserved features and species-specific adaptations:

Sequence Conservation Analysis:
Chlorobaculum parvum uppP shares significant sequence similarity with homologous enzymes from diverse bacterial phyla, with the highest conservation observed in:

  • Transmembrane domains containing catalytic residues

  • The putative substrate-binding pocket

  • Regions involved in phosphate coordination

Areas of lower conservation typically include cytoplasmic and periplasmic loops, which may reflect species-specific regulatory mechanisms or membrane environment adaptations .

Enzymatic Properties Comparison:

PropertyE. coli UppPB. subtilis BcrCPredicted C. parvum UppP
Substrate specificityUndecaprenyl pyrophosphateBroader specificityLikely specific for undecaprenyl pyrophosphate
pH optimum7.5-8.07.0-7.56.5-7.5 (environment-adapted)
Metal ion dependenceMg²⁺Mn²⁺Potentially Fe²⁺ (habitat-specific)
Bacitracin sensitivityModerateHighPredicted moderate

Structural Adaptations:
The photosynthetic lifestyle of Chlorobaculum parvum likely influences the properties of its uppP enzyme. As a green sulfur bacterium, C. parvum has specialized membrane structures for photosynthesis, which may necessitate adaptations in membrane proteins like uppP to function effectively in this unique environment . These adaptations could include:

  • Modified hydrophobic surfaces for interaction with chlorosome lipids

  • Altered substrate access pathways

  • Mechanisms to maintain function under the specific redox conditions

Understanding these comparative aspects provides valuable context for interpreting experimental results and predicting the behavior of Chlorobaculum parvum uppP in various experimental conditions.

What insights can be gained from studying evolutionary conservation patterns in uppP sequences?

Evolutionary analysis of uppP sequences across bacterial species reveals important insights into function and adaptation:

Phylogenetic Analysis:
Chlorobaculum parvum belongs to the green sulfur bacteria, a distinct phylogenetic group with specialized photosynthetic capabilities . Phylogenetic analysis of uppP sequences can:

  • Reveal the evolutionary history of this enzyme family

  • Identify potential horizontal gene transfer events

  • Correlate sequence variations with ecological niches

  • Guide the selection of homologs for comparative biochemical studies

Conservation Pattern Analysis:
Mapping conservation scores onto predicted structural models identifies:

  • Universally conserved residues (likely essential for catalytic function)

  • Phylum-specific conservation patterns (adaptations to membrane environment)

  • Variable regions (potential targets for selective inhibition)

Coevolution Analysis:
Statistical coupling analysis or direct coupling analysis of uppP sequences can identify:

  • Coevolving residue networks important for structural integrity

  • Functionally linked positions that may move together during catalysis

  • Residue interactions that compensate for adaptive mutations

Selective Pressure Analysis:
Calculating dN/dS ratios (nonsynonymous to synonymous substitution rates) across uppP sequences reveals:

  • Regions under purifying selection (functionally constrained)

  • Sites under positive selection (potential adaptive significance)

  • Lineage-specific selection patterns reflecting ecological specialization

These evolutionary insights help prioritize residues for mutagenesis studies, predict functional consequences of natural variations, and understand how uppP has adapted to diverse bacterial lifestyles, including the photosynthetic, anaerobic niche of Chlorobaculum parvum.

How can Chlorobaculum parvum uppP be used as a model system for studying antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase plays a significant role in bacterial resistance to certain antibiotics, particularly bacitracin, which targets the lipid carrier cycle in cell wall biosynthesis. Chlorobaculum parvum uppP can serve as a valuable model system for studying resistance mechanisms:

Bacitracin Resistance Studies:

  • Bacitracin binds to undecaprenyl pyrophosphate, preventing its dephosphorylation by uppP

  • Alterations in uppP expression or activity can confer resistance by accelerating the recycling of the lipid carrier

  • Comparative analysis of bacitracin sensitivity between wild-type and uppP-modified strains can quantify resistance levels

Resistance Mechanism Investigation Approaches:

  • Site-directed mutagenesis to identify residues affecting bacitracin binding or catalytic efficiency

  • Gene expression analysis to study transcriptional responses to antibiotic exposure

  • Heterologous expression of Chlorobaculum parvum uppP in model organisms to assess its effect on antibiotic susceptibility

  • In vitro competition assays between bacitracin and uppP for the substrate

Advantages of Chlorobaculum parvum as a Model System:

  • Distinct evolutionary lineage provides comparative insights

  • Photosynthetic lifestyle may reveal novel adaptations

  • Potential discovery of resistance mechanisms specific to environmental bacteria

This research direction has significant implications for understanding fundamental resistance mechanisms and potentially developing strategies to overcome antibiotic resistance in pathogens.

What emerging technologies will advance our understanding of uppP function and applications?

Several cutting-edge technologies hold promise for deepening our understanding of Chlorobaculum parvum uppP:

Advanced Structural Biology Technologies:

  • Time-resolved crystallography to capture catalytic intermediates

  • High-resolution cryo-EM with improved detectors and processing algorithms

  • Integrative structural biology combining multiple experimental techniques

  • Native mass spectrometry for membrane protein complexes

Functional Genomics Approaches:

  • CRISPR-Cas9 gene editing to study uppP function in native context

  • Deep mutational scanning for comprehensive structure-function mapping

  • RNA-Seq to understand transcriptional regulation under various conditions

  • ChIP-Seq to identify transcription factors regulating uppP expression

Single-Molecule Techniques:

  • Single-molecule FRET to monitor conformational changes during catalysis

  • Atomic force microscopy for mechanical properties and topography

  • Nanodiscs combined with single-molecule studies for native-like environment

  • Single-particle tracking in live cells to monitor dynamics

Computational Advances:

  • Enhanced molecular dynamics simulations with improved force fields

  • Machine learning approaches for predicting protein-ligand interactions

  • Quantum mechanics/molecular mechanics for reaction mechanism elucidation

  • Systems biology modeling of cell wall biosynthesis pathways

These emerging technologies, when applied to Chlorobaculum parvum uppP research, will provide unprecedented insights into its structure, function, regulation, and potential applications in biotechnology and pharmaceutical development.

What are the current knowledge gaps in understanding Chlorobaculum parvum uppP?

Despite significant progress in understanding bacterial undecaprenyl-diphosphatases, several important knowledge gaps remain for Chlorobaculum parvum uppP:

  • The three-dimensional structure of Chlorobaculum parvum uppP remains unresolved, limiting our understanding of its catalytic mechanism and substrate interactions .

  • The precise catalytic mechanism, including the roles of specific amino acid residues and potential metal cofactors, has not been experimentally determined for this specific homolog.

  • The regulation of uppP expression in Chlorobaculum parvum under different environmental conditions (light intensity, sulfide concentration, oxidative stress) is poorly understood.

  • The potential interactions between uppP and other components of the cell wall biosynthesis machinery in this photosynthetic bacterium have not been characterized.

  • The substrate specificity profile, including the ability to process alternative lipid pyrophosphates, has not been experimentally determined.

  • The role of uppP in adaptation to the specific ecological niche of Chlorobaculum parvum remains speculative and requires experimental verification.

Addressing these knowledge gaps will require a combination of structural, biochemical, and genetic approaches, potentially leveraging the comparative context provided by better-characterized homologs from model organisms.

How can integrated research approaches advance our understanding of bacterial cell wall biosynthesis through uppP studies?

An integrated research approach combining multiple techniques and perspectives offers the most promising path to comprehensive understanding of uppP's role in bacterial cell wall biosynthesis:

Multidisciplinary Research Framework:

  • Structural biology to determine three-dimensional architecture

  • Biochemistry to characterize enzymatic properties and inhibition profiles

  • Genetics to study function in the cellular context

  • Systems biology to place uppP in the broader metabolic network

  • Comparative biology to leverage insights across species

Integrative Experimental Design:

  • Combine in vitro biochemical assays with in vivo functional studies

  • Correlate structural features with enzymatic properties

  • Link molecular mechanisms to cellular phenotypes

  • Connect evolutionary patterns to functional adaptations

Collaborative Research Model:
Bringing together experts in:

  • Membrane protein biochemistry

  • Bacterial physiology and genetics

  • Structural biology and biophysics

  • Computational biology and bioinformatics

  • Photosynthesis and energy metabolism (specific to Chlorobaculum parvum)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.