Recombinant Chlorobium chlorochromatii ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; Cag_0066; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
atpF
Target Protein Sequence
MLTSGTILLAGSLLSPNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDR AEKAKDEAEAILRKNRELLSKADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASAK EEIEQEKRRALDVLRNEVADLAVLGAERIIRESLNADMQKKVVASMIQDMSSKRN
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk and linking the F1 and F0 domains.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How does expression of atpF differ between symbiotic and free-living states of Chlorobium chlorochromatii?

The expression pattern of atpF in Chlorobium chlorochromatii shows significant differences between symbiotic and free-living states, reflecting adaptive metabolic adjustments:

In symbiotic state (within 'Chlorochromatium aggregatum'):

  • Differential expression of ~350 genes occurs between symbiotic and free-living states

  • ATP synthase components, including atpF, show altered expression patterns

  • Changes correlate with nitrogen metabolism and energy production adjustments

  • Expression levels reflect limited nitrogen conditions where GS/GOGAT pathway actively assimilates ammonia from N₂ fixation

Methodologically, these differences can be studied using:

  • RNA-Seq comparing transcriptomes of symbiotic vs. free-living cells

  • Quantitative proteomics using techniques like 2-D DIGE (Differential Gel Electrophoresis)

  • Western blot analysis with antibodies specific to atpF

  • Elementary flux mode (EFM) analysis to model metabolic networks under different conditions

Recent studies showed that in symbiosis, Chlorobium chlorochromatii operates under nitrogen-limited conditions, which likely impacts energy metabolism and ATP synthase expression patterns . These expression differences suggest adaptation to the unique metabolic needs of the symbiotic relationship.

  • What approaches can elucidate interactions between ATP synthase subunit b and other components in the membrane sector?

Multiple complementary approaches can reveal interactions between ATP synthase subunit b and other membrane components:

Crosslinking studies:

  • Chemical crosslinking using agents like DSP, DTSSP, or BS³

  • Photoactivatable crosslinkers for spatially restricted interaction mapping

  • Mass spectrometry analysis of crosslinked peptides to identify interaction sites

Co-immunoprecipitation methods:

  • Express recombinant atpF with affinity tag (His, FLAG, etc.)

  • Solubilize membranes with mild detergents (DDM or digitonin)

  • Perform pull-down experiments with tagged protein

  • Identify interacting partners by mass spectrometry

Biophysical interaction studies:

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

Recent research on bacterial ATP synthases suggests that subunit b interacts primarily with subunit a in the membrane domain and with subunit δ in the peripheral stalk . When designing experiments, researchers should consider the hydrophobic nature of the membrane environment and use appropriate detergents to maintain protein-protein interactions.

  • How can cryo-EM be used to determine the structure of Chlorobium chlorochromatii ATP synthase complex?

Cryo-electron microscopy (cryo-EM) has become a powerful tool for resolving ATP synthase structures, with specific methodological considerations for Chlorobium chlorochromatii:

Sample preparation protocol:

  • Express and purify the complete ATP synthase complex or reconstitute from purified components

  • Remove detergent using either:

    • Amphipol exchange (e.g., A8-35)

    • Reconstitution into nanodiscs with MSP proteins and lipids

    • Incorporation into liposomes followed by detergent removal

  • Concentrate to 2-5 mg/ml for optimal particle density

  • Apply 3-4 μl to glow-discharged grids (Quantifoil R1.2/1.3)

  • Vitrify using rapid plunging into liquid ethane

Data collection parameters:

  • Voltage: 300 kV

  • Defocus range: -0.8 to -2.5 μm

  • Total dose: 40-60 e⁻/Ų

  • Dose rate: 4-8 e⁻/pixel/s

  • Frame count: 30-40 frames per movie

Data processing workflow:

  • Motion correction using MotionCor2

  • CTF estimation with CTFFIND4 or Gctf

  • Particle picking using reference-free methods (cryoSPARC) or template-based approaches

  • 2D classification to select well-defined particle classes

  • Ab initio model generation and 3D classification

  • 3D refinement with imposed symmetry (if applicable)

  • Post-processing with local resolution estimation

Recent cryo-EM studies of bacterial ATP synthases have achieved resolutions of 2.7-3.5 Å, revealing detailed interactions between subunits . The rotary states of ATP synthase can be captured through image classification approaches, providing insights into the catalytic mechanism.

  • What role does ATP synthase play in the symbiotic relationship within 'Chlorochromatium aggregatum'?

ATP synthase likely plays a critical role in energy metabolism adaptation within the symbiotic relationship of 'Chlorochromatium aggregatum':

Energy exchange hypothesis:

  • The consortium exhibits metabolic syntrophy of nitrogen and carbon sources

  • ATP synthase activity in Chlorobium chlorochromatii powers ATP generation for nitrogen fixation

  • In symbiosis, Chlorobium chlorochromatii operates under nitrogen-limited conditions

  • ATP synthase efficiency may be modulated to balance energy needs between symbionts

Experimental approaches to test this hypothesis:

  • Comparative proteomics to quantify ATP synthase components in symbiotic vs. free-living states

  • Membrane potential measurements using fluorescent probes

  • ATP synthesis rate measurements in isolated symbionts

  • Metabolic flux analysis using isotope-labeled substrates

Recent studies suggest that the symbiotic relationship involves exchange of 2-oxoglutarate from the β-proteobacterium to enhance N₂ fixation in Chlorobium chlorochromatii . ATP synthase expression and activity likely adapt to these metabolic demands, with potential regulation at both transcriptional and post-translational levels.

ConditionNitrogen AssimilationATP Synthase Regulation
SymbioticGS/GOGAT pathway activeOptimized for enhanced ATP production
Free-livingAlaDH pathway predominantDifferent regulatory state
  • How does the proton-coupling mechanism in Chlorobium chlorochromatii ATP synthase compare to sodium-coupled ATP synthases?

The proton-coupling mechanism in Chlorobium chlorochromatii ATP synthase likely differs from sodium-coupled ATP synthases in several key aspects:

Key mechanistic differences:

  • Chlorobium belongs to green sulfur bacteria which typically utilize protons (H⁺) rather than sodium ions (Na⁺) for ATP synthesis

  • The c-ring structure determines ion specificity through binding site modifications

  • Proton-coupled ATP synthases typically have a conserved glutamate/aspartate residue in the c-subunit for H⁺ binding

Comparative analysis approaches:

  • Site-directed mutagenesis of key residues in c-subunit to identify proton-binding sites

  • Ion selectivity experiments by reconstitution in liposomes with different ion gradients

  • Structural comparison of c-rings from H⁺-coupled vs. Na⁺-coupled ATP synthases

Studies on the thermoalkaliphilic Bacillus sp. strain TA2.A1 ATP synthase showed that neither ATP synthesis nor ATP hydrolysis was stimulated by Na⁺ ions, suggesting protons as the coupling ions . This aligns with findings from most bacterial ATP synthases. The specificity appears to be determined primarily by the c-ring structure rather than subunit a .

Researchers investigating ion specificity should examine the amino acid sequence of atpF and related c-subunits for conserved motifs associated with proton binding, particularly focusing on transmembrane segments that form ion channels.

  • How can evolutionary analysis of atpF sequences provide insights into adaptation of Chlorobium species to different environments?

Evolutionary analysis of atpF sequences can reveal adaptation patterns:

Methodological approach for evolutionary analysis:

  • Collect atpF sequences from multiple Chlorobium species and related green sulfur bacteria

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

  • Calculate selection metrics (dN/dS ratios) to identify sites under positive selection

  • Map conserved and variable regions onto structural models

Key insights from comparative analyses:

  • atpF sequences from Chlorobium chlorochromatii vs. Chlorobium phaeobacteroides show specific differences

  • Symbiotic species may exhibit different selective pressures on ATP synthase components

  • Environmental adaptations (temperature, pH, salt) correlate with specific sequence modifications

When conducting evolutionary analyses, researchers should focus on specific functional domains of the protein and consider the constraints imposed by protein-protein interactions within the ATP synthase complex.

  • What methodologies can assess the impact of environmental factors on atpF expression and function?

Multiple methodologies can assess environmental impacts on atpF expression and function:

Expression analysis approaches:

  • RT-qPCR to measure transcript levels under varying conditions:

    • Different light intensities (for photosynthetic bacteria)

    • Sulfide concentrations (electron donor for green sulfur bacteria)

    • Oxygen levels (anaerobic vs. microaerobic)

    • Nitrogen availability

  • Proteomics to quantify protein abundance changes:

    • 2D-DIGE for comparative analysis

    • SILAC or TMT labeling for quantitative mass spectrometry

    • Western blotting with atpF-specific antibodies

Functional assessment methods:

  • ATP synthesis/hydrolysis assays in membrane vesicles

  • Membrane potential measurements using fluorescent probes

  • Growth rate analysis under varied environmental conditions

  • Biophysical stability studies (thermal shift assays) of purified protein

Research on Chlorobium tepidum has shown that environmental adaptations in energy metabolism involve regulation of several genes, including ATP synthase components . Importantly, when designing experiments to study environmental impacts, researchers should consider the natural habitat of Chlorobium chlorochromatii - typically anoxic, sulfide-rich environments with specific light conditions.

  • How can isotope labeling techniques be applied to study ATP synthase assembly and dynamics in Chlorobium chlorochromatii?

Isotope labeling offers powerful approaches to study ATP synthase dynamics:

Metabolic labeling strategies:

  • ¹⁵N/¹³C incorporation for NMR studies:

    • Grow Chlorobium chlorochromatii in media containing ¹⁵NH₄Cl and/or ¹³C-glucose

    • Purify ATP synthase or specific subunits like atpF

    • Perform NMR analysis to examine protein dynamics and interactions

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture):

    • Culture cells in media with heavy (¹³C, ¹⁵N) or light isotope-labeled amino acids

    • Compare protein abundance between different conditions

    • Determine assembly kinetics by pulse-chase experiments

Hydrogen/deuterium exchange mass spectrometry (HDX-MS):

  • Expose ATP synthase complexes to D₂O for varied time intervals

  • Quench the exchange reaction

  • Digest with pepsin and analyze by mass spectrometry

  • Map exchange rates to protein structure

  • Identify regions involved in subunit interactions

Pulse-chase experiments:

  • Add isotope-labeled amino acids for a short pulse period

  • Chase with unlabeled amino acids

  • Immunoprecipitate ATP synthase at different timepoints

  • Analyze subunit incorporation by mass spectrometry

These methodologies can reveal assembly intermediates and kinetics, providing insights into how the atpF subunit incorporates into the ATP synthase complex. Studies on cF₁ assembly in chloroplasts found that chaperones like CPN60 and CPN20 are essential for proper assembly , suggesting similar mechanisms might exist in Chlorobium.

  • What computational approaches can predict structural changes in ATP synthase subunit b under different environmental conditions?

Advanced computational approaches can predict structural adaptations of atpF:

Molecular dynamics (MD) simulation protocol:

  • Build homology model of Chlorobium chlorochromatii atpF using established structures

  • Embed protein in appropriate membrane environment (POPC/POPG lipid bilayer)

  • Perform equilibration (10-50 ns) followed by production runs (100-500 ns)

  • Analyze simulations under varied conditions:

    • Different temperatures (10-50°C)

    • pH variations (simulated through protonation state changes)

    • Varied lipid compositions

    • Salt concentrations (0-500 mM)

Key analysis metrics:

Advanced simulation approaches:

  • Coarse-grained simulations (MARTINI force field) for longer timescales

  • Replica exchange molecular dynamics for enhanced sampling

  • Free energy calculations for specific conformational changes

  • Multiscale modeling combining atomistic and coarse-grained approaches

Recent computational studies on ATP synthases have revealed that the peripheral stalk, including subunit b, exhibits flexibility that accommodates the rotational states of the complex . When modeling Chlorobium chlorochromatii atpF, researchers should pay particular attention to the membrane-spanning N-terminal region and its interaction with lipids characteristic of green sulfur bacterial membranes.

  • How can researchers investigate post-translational modifications of atpF in Chlorobium chlorochromatii?

Post-translational modifications (PTMs) of atpF can be investigated using several complementary approaches:

Mass spectrometry-based PTM identification protocol:

  • Isolate ATP synthase complex or purify recombinant atpF

  • Perform enzymatic digestion with multiple proteases for optimal coverage:

    • Trypsin (cleaves at K/R)

    • Chymotrypsin (cleaves at F/Y/W)

    • GluC (cleaves at E/D)

  • Analyze peptides using high-resolution MS/MS (Orbitrap or Q-TOF)

  • Search for common PTMs:

    • Phosphorylation (Ser, Thr, Tyr)

    • Acetylation (Lys)

    • Methylation (Lys, Arg)

    • Oxidation (Met, Cys)

Site-directed mutagenesis for functional validation:

  • Identify putative modification sites from MS data

  • Generate mutants that either:

    • Prevent modification (e.g., Ser→Ala for phosphorylation sites)

    • Mimic modification (e.g., Ser→Asp for phosphorylation)

  • Compare activity and assembly properties of wild-type vs. mutant proteins

In vivo PTM detection approaches:

  • Antibodies specific to the modification of interest

  • Phospho-specific protein staining (ProQ Diamond)

  • Click chemistry for detection of specific modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.