Recombinant Chlorobium chlorochromatii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Enzymatic Role

Recombinant Chlorobium chlorochromatii Cobalamin Synthase (CobS) is a cobaltochelatase enzyme involved in the oxygen-dependent cobalamin (vitamin B<sub>12</sub>) biosynthesis pathway. CobS catalyzes the insertion of cobalt into hydrogenobyrinate a,c-diamide, forming cob(II)yrinate a,c-diamide, a critical step in corrin ring assembly . This enzyme operates as part of a heterotrimeric complex (CobNST) homologous to magnesium chelatases (BchHID/ChlHID) in chlorophyll/bacteriochlorophyll pathways .

Challenges in Recombinant CobS Production

Heterologous expression of CobS in E. coli reveals systemic bottlenecks:

  • Membrane Disruption: Overexpression of Rhodobacter capsulatus CobS in E. coli dissipates proton motive force (PMF), increasing membrane permeability and arresting growth .

  • Cofactor Dependency: CobS activity requires reducing conditions (DTT) and is inhibited by EDTA, indicating metal cofactor reliance .

  • Complex Assembly: Functional CobNST requires stoichiometric expression of CobN, CobS, and CobT. Imbalanced expression in E. coli reduces cobamide yields .

Metabolic Engineering Applications

Efforts to optimize CobS for industrial cobalamin production highlight:

  • Cobalt Uptake Enhancement: Co-expression of cobalt transporters (CbiMNQO) increases intracellular cobalt availability, improving cobamide synthesis .

  • Pathway Balancing: Co-expression with phosphatase CobC or stress protein PspA counteracts CobS-induced membrane damage .

Unresolved Questions and Research Gaps

  • Substrate Channeling: How CobS coordinates with CobN/CobT for corrinoid intermediate transfer remains unclear.

  • Regulatory Isoforms: C. chlorochromatii may employ paralogs (e.g., BchS/BchH) to modulate CobS activity under varying nitrogen/sulfide conditions .

  • Ecological Adaptations: No free-living C. chlorochromatii populations have been observed, raising questions about CobS regulation in symbiotic consortia .

Comparative Activity of CobS Homologs

OrganismCobS ActivityCobalamin Yield (µg/g DCW)Key Reference
E. coli (engineered)Requires CobN/CobT307.00 (optimized)
Rhodobacter capsulatusOxygen-dependentNot quantified
Chlorobaculum tepidumLight-independent (DPOR)N/A

Future Directions

  • Structural Resolution: Cryo-EM studies of C. chlorochromatii CobNST could elucidate cobalt insertion mechanics.

  • Synthetic Consortia: Leveraging C. chlorochromatii’s symbiotic metabolism may enhance CobS stability in bioreactors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Cag_1057; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
cobS
Target Protein Sequence
MLGGLVTALRTLTILPIPGKDAVTFSHSLYWFPFVGLLLGALLAALGYVGSLSGWHEFAA LLVVLGGIVLTRGMHADGLADVADGFWGGRSKEAALRIMKDPTVGSFGALALSGVMLLKW VAVVRLLSFGLFDVVMAGILLARLVQVLLASALPYARREAGTASAFVAGAGAPHAFSALL FTLALLFPFYTENFPTMLWLLGAALVAGSMVGMVSYRKIGGVTGDVLGAGSELTEVAVWI TGALLLSDYLLF
Uniprot No.

Target Background

Function
Catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what is its role in Chlorobium chlorochromatii?

Cobalamin synthase (CobS) is a polytopic integral membrane protein that catalyzes the penultimate step of coenzyme B12 (cobalamin) biosynthesis . In Chlorobium chlorochromatii, a green sulfur bacterium that forms part of the phototrophic consortium "Chlorochromatium aggregatum," CobS plays a crucial role in the anaerobic pathway for cobalamin biosynthesis .

The enzyme functions within a complex biosynthetic pathway that involves multiple steps. CobS specifically catalyzes the assembly of the nucleotide loop component of the cobalamin molecule, connecting the lower axial ligand to the corrin ring structure. This reaction is critical for producing functional B12, which serves as an essential cofactor for various metabolic processes in the organism.

In Chlorobium species, the importance of cobalamin biosynthesis is highlighted by the presence of complete gene clusters for this pathway, including cbiD, cbiJ, cbiL, cbiK, cysG, and bifunctional genes like cbiFG, cbiET, and cbiHC . This genetic machinery allows these bacteria to synthesize cobalamin de novo under anaerobic conditions.

How does CobS relate to the magnesium chelatase complex in Chlorobium species?

Cobalamin synthase (CobS) shares an evolutionary relationship with components of the magnesium chelatase complex. Research has revealed that the CobN, CobS, and CobT subunits of the trimeric cobalt chelatase are homologous with the BchH/ChlH, BchI/ChlI, and BchD/ChlD subunits of magnesium chelatase, respectively . This homology has been interpreted as reflecting ancient duplication and divergence events .

In Chlorobium species, both systems coexist, with gene clusters containing cobaltochelatase (cobN) and three magnesium chelatase genes (bchD, bchH, bchI) identified in their genomes . This genetic architecture suggests a functional relationship between the two pathways - cobalamin biosynthesis and (bacterio)chlorophyll synthesis - that is particularly relevant in photosynthetic bacteria.

The evolutionary relationship between these systems is further evidenced by the presence of BchI/ChlI homologs in some cobalamin-producing organisms that lack CobS, where these genes likely substitute for the missing CobNST genes . This distribution pattern suggests that pre-existing building blocks could have been recruited into the assembly of the ancestral chlorophyll and O2-dependent cobalamin pathways.

Is CobS expression regulated seasonally in natural Chlorobium populations?

Yes, studies on Antarctic Chlorobium populations have revealed seasonal patterns in the expression of genes involved in cobalamin biosynthesis, including those associated with cobaltochelatase and related transport systems. Research on Chlorobium species in Ace Lake, Antarctica, showed that the proportion of the population possessing genes within Lineage-specific Core Regions (LCRs) related to cobalamin synthesis and transport tends to be higher in summer than in winter or spring .

This seasonal regulation likely reflects adaptation to changing environmental conditions, particularly light availability, which affects the photosynthetic activity of these green sulfur bacteria. Since cobalamin is essential for various metabolic processes, the ability to regulate its synthesis according to seasonal needs provides an ecological advantage in environments with strong seasonal variations.

What expression systems are most suitable for producing functional recombinant Chlorobium chlorochromatii CobS?

For producing functional recombinant CobS from Chlorobium chlorochromatii, heterologous expression systems must address several challenges related to membrane protein production. Based on research with similar membrane proteins, the following expression systems are recommended:

Table 1: Comparison of Expression Systems for Recombinant CobS Production

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli C41/C43High yield, well-established protocolsMay form inclusion bodiesRequires optimization of membrane insertion
Lactococcus lactisBetter membrane insertionLower yield than E. coliRecommended for structural studies
Cell-free systemsAvoids toxicity issuesHigher costRequires supplied lipids or nanodiscs
Insect cell linesSuperior folding for complex proteinsTime-consuming, expensiveConsider for detailed functional studies

When using E. coli-based systems, expression should be conducted under anaerobic or microaerobic conditions since CobS is naturally part of an anaerobic pathway. Additionally, co-expression with chaperones may improve folding and membrane insertion.

What are the optimal conditions for isolating and purifying recombinant CobS?

Isolation and purification of recombinant CobS requires specialized protocols for membrane proteins. Based on methodologies applied to similar proteins including cobamide synthase from other organisms, the following protocol is recommended:

  • Cell Lysis: Harvest cells by centrifugation at 10,000 × g for 30 minutes and resuspend in buffer (typically 10 mM Tris, pH 7.5) . Use French press (110 MPa, three passages) or sonication for effective membrane disruption.

  • Membrane Fraction Isolation: Remove unbroken cells by centrifugation at 2,000 × g for 5 minutes, followed by collection of membrane fractions at higher speeds (typically 100,000 × g for 1 hour) .

  • Solubilization: Solubilize membrane fractions using detergents. For CobS, mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% (w/v) are recommended to maintain protein structure and function.

  • Purification Strategy:

    • Initial purification: Immobilized metal affinity chromatography (IMAC) using a His-tag if incorporated in the recombinant construct

    • Secondary purification: Size exclusion chromatography to remove aggregates and improve purity

    • Consider ion exchange chromatography as an additional step if higher purity is required

  • Buffer Optimization: Use buffers containing stabilizing agents like glycerol (10-15%) and appropriate detergent concentrations (typically 0.05-0.1% DDM) to maintain protein stability throughout purification.

Recent methodological improvements for cobamide synthase isolation highlight the importance of liposome enhancement for preserving CobS activity . Incorporating the purified protein into liposomes or nanodiscs can significantly improve stability and functional analysis capabilities.

How can the activity of recombinant CobS be assayed reliably?

Assessing the activity of recombinant CobS requires specialized techniques that account for its membrane-associated nature and specific catalytic function. The following methodologies are recommended:

  • Radioisotope-based assays: Using radiolabeled substrates (typically 57Co-labeled precursors) to track the incorporation into cobalamin products. This traditional approach allows quantitative measurement of CobS activity.

  • HPLC/LC-MS analysis: High-performance liquid chromatography coupled with mass spectrometry can detect and quantify the conversion of substrates to products. This method offers high sensitivity and specificity.

  • Reconstituted systems: For comprehensive functional studies, reconstituting CobS with other components of the cobalamin biosynthetic pathway in liposomes creates a more native-like environment. This approach allows examination of substrate channeling and protein-protein interactions.

  • Liposome-enhanced activity measurement: Recent research highlights significantly improved CobS activity when the protein is incorporated into liposomes . This approach better mimics the native membrane environment and can overcome common challenges in measuring membrane protein activity in detergent solutions.

For reliable results, controls should include heat-inactivated enzyme preparations and reactions lacking key substrates or cofactors. Additionally, because CobS functions in an anaerobic pathway in Chlorobium, assays should be conducted under anaerobic conditions to preserve enzyme activity.

What is known about the structure-function relationship of CobS in Chlorobium species?

While detailed structural information specific to Chlorobium chlorochromatii CobS remains limited, comparative analysis with homologous proteins provides insights into its structure-function relationship:

CobS belongs to a family of polytopic integral membrane proteins . Its membrane association is critical for function, likely creating a protected environment for the sensitive intermediates of cobalamin biosynthesis. The protein contains multiple transmembrane helices that anchor it in the membrane and create a catalytic site accessible to both cytoplasmic and periplasmic sides.

The functional domains of CobS include:

  • Substrate binding regions for the corrinoid precursor

  • Nucleotide binding domains for the lower ligand attachment

  • Potential interfaces for interaction with other pathway enzymes

Research on cobalamin biosynthesis in Chlorobium species indicates that CobS works in concert with other enzymes of the anaerobic pathway, particularly those encoded by the gene cluster containing cbiD, cbiJ, cbiL, cbiK, cysG, and bifunctional genes . This arrangement suggests that substrate channeling and protein-protein interactions may be important aspects of CobS function in vivo.

Evolutionary analysis shows that CobS shares homology with components of the magnesium chelatase complex , suggesting conserved structural elements despite divergent functions. This relationship provides a framework for understanding CobS structure through comparative modeling approaches.

How does recombinant CobS interact with other components of the cobalamin biosynthetic pathway?

Recombinant CobS interacts with multiple components of the cobalamin biosynthetic pathway, functioning within a complex network of enzymes. These interactions are critical for efficient biosynthesis through substrate channeling and coordinated catalysis.

Key interactions include:

  • Upstream enzymes: CobS receives its substrate from earlier enzymes in the pathway, particularly those involved in corrin ring synthesis and modification. In Chlorobium, these include products of the cbi gene cluster (CbiD, CbiJ, CbiL, CbiK, etc.) .

  • CobT and CobN relationship: Based on homology with magnesium chelatase systems, CobS likely interacts with CobT and potentially CobN components . This interaction may be important for coordinating cobalt insertion with nucleotide loop attachment.

  • Membrane protein complexes: As a membrane protein, CobS may localize to specific membrane regions or form complexes with other membrane-associated components of the pathway.

  • Downstream enzyme (CobP/CobV): CobS must coordinate with the final enzyme in the pathway to ensure efficient transfer of its product for completion of cobalamin synthesis.

For studying these interactions with recombinant CobS, the following approaches are recommended:

  • Co-immunoprecipitation with tagged versions of pathway components

  • Cross-linking studies combined with mass spectrometry

  • Fluorescence resonance energy transfer (FRET) using fluorescently labeled proteins

  • Reconstitution studies in liposomes with multiple pathway components

Research on Chlorobium species suggests that optimal study of these interactions should consider the native environment of these bacteria, including anaerobic conditions and appropriate pH (typically around 7.2-7.5) .

What techniques are most effective for studying the membrane topology of recombinant CobS?

Determining the membrane topology of recombinant CobS is essential for understanding its function and mechanism. The following techniques have proven effective for membrane protein topology studies and are recommended for CobS research:

  • Cysteine scanning mutagenesis: This approach involves creating a cysteine-free version of CobS, then introducing individual cysteines at different positions. Accessibility of these cysteines to membrane-impermeable reagents reveals their location relative to the membrane.

  • Reporter fusion approach: Fusing topology reporter proteins (such as GFP, PhoA, or LacZ) to truncated versions of CobS can determine the orientation of specific regions relative to the membrane.

  • Protease protection assays: When performed on CobS reconstituted into liposomes or membrane vesicles, these assays can identify regions protected by the membrane.

  • Cryo-electron microscopy: For high-resolution structural information, cryo-EM has become increasingly valuable for membrane proteins, especially when combined with liposome or nanodisc reconstitution.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can provide information about solvent-accessible regions and has been successfully applied to membrane proteins.

Table 2: Comparison of Topology Determination Methods for Recombinant CobS

MethodResolutionTechnical DifficultySample RequirementsKey Advantages
Cysteine scanningMediumModeratePurified protein, mutantsCan map entire topology systematically
Reporter fusionsLowLow-ModerateExpression constructsWorks in vivo, good for initial mapping
Protease protectionLow-MediumLowPurified proteinSimple technique, minimal equipment
Cryo-EMHighVery HighHighly purified protein (mg)Provides detailed structural information
HDX-MSMedium-HighHighPurified proteinMaps dynamics and accessibility

When studying CobS from Chlorobium chlorochromatii, adaptation of techniques used for the ultrastructural characterization of this organism may provide valuable insights into protein localization and membrane association in its native context.

How does the anaerobic lifestyle of Chlorobium chlorochromatii affect recombinant CobS expression and function?

Chlorobium chlorochromatii is naturally adapted to anaerobic environments, and this has significant implications for recombinant CobS production and functional studies. The anaerobic lifestyle affects CobS in several ways:

  • Oxygen sensitivity: The anaerobic cobalamin biosynthetic pathway in Chlorobium involves oxygen-sensitive intermediates and enzymes. Recombinant CobS likely retains this sensitivity, requiring anaerobic conditions during expression and purification to maintain functionality.

  • Post-translational modifications: Proteins expressed in anaerobic organisms may undergo different post-translational modifications compared to aerobic expression hosts. These modifications could be critical for CobS function.

  • Redox environment: The reducing environment of anaerobic cells may be necessary for proper folding and function of CobS. Expression in aerobic systems might require addition of reducing agents to mimic this environment.

  • Metal availability and incorporation: Cobalamin biosynthesis requires specific metal incorporation, particularly cobalt. The anaerobic environment affects metal availability and oxidation state, which may impact CobS function.

For optimal recombinant expression, the following strategies are recommended:

  • Use of anaerobic expression systems or expression under microaerobic conditions

  • Inclusion of reducing agents in growth media and purification buffers

  • Consideration of metal supplementation, particularly cobalt compounds

  • Use of specialized anaerobic chambers for protein purification and functional assays

Growth conditions similar to those used for native Chlorobium chlorochromatii (pH 7.2, 25°C, low light intensity of 50 μmol quanta·m−2·s−1) may provide insights for optimizing recombinant expression conditions.

What site-directed mutagenesis approaches can reveal the catalytic mechanism of CobS?

Site-directed mutagenesis is a powerful approach for elucidating the catalytic mechanism of CobS. Based on knowledge of similar enzymes and the cobalamin biosynthetic pathway, the following mutagenesis strategy is recommended:

  • Conserved residue targeting: Identify highly conserved residues across CobS homologs, particularly those in predicted catalytic domains. Primary targets should include:

    • Charged residues (Asp, Glu, Lys, Arg) that may participate in acid-base catalysis

    • Potential metal-coordinating residues (His, Cys)

    • Residues involved in substrate binding (aromatic and polar amino acids)

  • Transmembrane domain analysis: Create systematic mutations in predicted transmembrane regions to identify residues involved in substrate channeling or that create the catalytic environment.

  • Interface residues: Target amino acids at predicted interfaces with other pathway components, particularly those that might interact with CobT or other cobalamin biosynthesis enzymes.

  • Conservative vs. non-conservative substitutions: For each targeted position, create both conservative (maintaining similar properties) and non-conservative mutations to distinguish between structural and catalytic roles.

Table 3: Priority Mutation Targets for CobS Catalytic Mechanism Studies

Target TypeMutation ApproachExpected OutcomeAnalysis Method
Catalytic residuesAla substitutionLoss of catalytic activityActivity assays
Metal coordinationHis/Cys to AlaAltered metal bindingICP-MS, EPR spectroscopy
Substrate bindingConservative substitutionsAltered substrate affinityBinding assays, kinetics
TransmembraneScanning mutagenesisChanged topology or functionTopology mapping, activity
Interface residuesCharge reversalDisrupted protein interactionsCo-IP, interaction assays

For each mutant, comprehensive characterization should include:

  • Expression and membrane integration analysis

  • Protein stability assessment

  • Detailed kinetic studies comparing to wild-type CobS

  • Substrate binding analysis

  • Metal content determination

How can systems biology approaches enhance our understanding of CobS function in the context of Chlorobium metabolism?

Systems biology approaches provide powerful tools for understanding CobS function within the broader metabolic network of Chlorobium chlorochromatii. These approaches can reveal how CobS activity is integrated with other cellular processes, particularly in the context of photosynthesis, symbiosis, and adaptation to environmental conditions.

Recommended systems biology strategies include:

Implementation of these approaches should consider the unique ecological niche of Chlorobium chlorochromatii, particularly its role in the Chlorochromatium aggregatum consortium and the seasonal variations observed in Antarctic populations .

What are the challenges in scaling up recombinant CobS production for structural studies?

Scaling up recombinant CobS production for structural studies presents several challenges that must be addressed through careful optimization:

  • Membrane protein overexpression toxicity: High-level expression of membrane proteins like CobS often causes toxicity to host cells, limiting yield. Strategies to overcome this include:

    • Use of specialized strains designed for membrane protein expression

    • Controlled induction systems with tunable expression levels

    • Expression as fusion proteins with solubility-enhancing partners

  • Functional folding and membrane insertion: Ensuring proper folding and membrane insertion becomes more challenging at scale. Consider:

    • Co-expression with chaperones specific for membrane proteins

    • Optimization of growth temperature and induction conditions

    • Addition of specific lipids to growth media that may facilitate proper folding

  • Purification challenges:

    • Scaling up detergent-based extraction while maintaining cost-effectiveness

    • Preventing aggregation during concentration steps

    • Maintaining protein stability during extended purification procedures

  • Structural homogeneity: Obtaining structurally homogeneous preparations is essential for techniques like crystallography and cryo-EM. This requires:

    • Extensive screening of detergents and buffer conditions

    • Advanced purification techniques like GraFix or anion exchange chromatography

    • Careful monitoring of protein quality using techniques like FSEC (fluorescence-detection size exclusion chromatography)

  • Functional verification at scale: Ensuring that scaled-up preparations retain catalytic activity through:

    • Development of high-throughput activity assays

    • Correlation of structural integrity with functional assays

    • Stability testing under various storage conditions

Based on research with other membrane proteins and specifically cobamide synthase, incorporating the protein into nanodiscs or liposomes has shown significant promise for structural studies . For Chlorobium chlorochromatii CobS, adaptation of methods used for chlorosome isolation might provide insights into handling this membrane protein while maintaining its native-like environment.

What are common pitfalls in recombinant CobS expression and how can they be addressed?

Researchers working with recombinant Chlorobium chlorochromatii CobS frequently encounter several challenges. The following table outlines common problems and effective solutions:

Table 4: Troubleshooting Guide for Recombinant CobS Expression

ProblemPossible CausesSolutions
Low expression yieldToxicity to host cells, poor codon usageUse C41/C43 E. coli strains, optimize codon usage, lower induction temperature (15-20°C)
Inclusion body formationImproper folding, aggregationCo-express with chaperones, use mild detergents during lysis, consider fusion tags (SUMO, MBP)
Loss of activity during purificationDetergent effects, cofactor lossScreen detergent panel, supplement with potential cofactors, minimize purification steps
Inconsistent activity assaysOxygen sensitivity, variable substrate qualityPerform assays anaerobically, standardize substrate preparation
Poor membrane integrationOverexpression overwhelming insertion machineryReduce expression rate, consider specialized membrane protein expression systems
Degradation during purificationProtease activity, instabilityInclude protease inhibitors, maintain low temperature, minimize time in detergent

When working specifically with CobS from Chlorobium chlorochromatii, consider adapting the growth conditions used for the native organism: pH 7.2, 25°C, under low light intensity . These conditions may provide insights for optimizing recombinant expression.

For membrane fraction isolation, following protocols similar to those used for chlorosome isolation might improve recovery of functional protein: centrifugation at 10,000 × g for 30 min for cell harvesting, followed by French press lysis and differential centrifugation.

How can researchers overcome challenges in measuring CobS activity in vitro?

Measuring the activity of recombinant CobS in vitro presents several technical challenges due to its nature as a membrane protein and its involvement in a complex biosynthetic pathway. The following strategies can help overcome these challenges:

  • Liposome reconstitution: Recent research highlights that incorporating CobS into liposomes significantly enhances its activity . Prepare liposomes from E. coli lipids or synthetic mixtures that mimic the native membrane composition of Chlorobium.

  • Substrate accessibility: Ensure that substrates can access the active site by:

    • Optimizing detergent type and concentration if working in detergent solutions

    • Creating permeable liposomes for reconstituted systems

    • Using substrate analogs with improved membrane permeability

  • Coupled enzyme assays: Develop assays that couple CobS activity to more easily detectable reactions, such as:

    • Fluorescent or colorimetric detection of reaction products

    • Coupling to enzymes that produce detectable signals

    • Using radiolabeled substrates with scintillation proximity assays

  • Anaerobic techniques: Maintain anaerobic conditions throughout the assay to prevent inactivation of oxygen-sensitive components:

    • Perform experiments in anaerobic chambers

    • Use oxygen-scavenging systems in reaction buffers

    • Pretreat all buffers to remove dissolved oxygen

  • Cofactor supplementation: Ensure all necessary cofactors are present:

    • Include potential metal cofactors, particularly cobalt

    • Add reducing agents to maintain proper redox environment

    • Consider additional factors that might be required for full activity

By addressing these challenges systematically, researchers can develop robust assays for recombinant CobS activity that provide meaningful insights into its catalytic mechanism and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.