Recombinant Chlorobium chlorochromatii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Characteristics of Chlorobium chlorochromatii

Chlorobium chlorochromatii CaD3 is a non-motile bacterium capable of nitrogen and carbon fixation, utilizing sulfide as an electron donor for anoxygenic photosynthesis . In its symbiotic state, Chlorobium chlorochromatii CaD3 experiences limited nitrogen conditions, leading to active assimilation of ammonia via the glutamine synthetase/glutamate synthetase (GS/GOGAT) pathway . Conversely, in a free-living state, it encounters nitrogen excess and assimilates ammonia through the alanine dehydrogenase (AlaDH) pathway .

Metabolic Interactions and Symbiosis

The metabolic interactions within ‘Chlorochromatium aggregatum’ involve the exchange of metabolites between Chlorobium chlorochromatii CaD3 and the central β-proteobacterium . The chlorobia can enhance nitrogen fixation through the injection of 2-oxoglutarate from the β-proteobacterium via the periplasm . This arrangement provides motility, which is crucial for a phototrophic bacterium, along with syntrophy for nitrogen and carbon sources .

Genetic and Genomic Features

Pangenomic analysis of Chlorobium species, including C. chlorochromatii, reveals a core set of genes and gene clusters shared among different strains . These bacteria possess the potential for carbon fixation via the reductive tricarboxylic acid (rTCA) cycle, sulfur oxidation, and sulfate assimilation . They also exhibit mixotrophic capabilities, combining autotrophic and heterotrophic metabolisms .

Mechanosensitive Channels

MscL channels are known to respond to mechanical stimuli, such as changes in membrane tension . These channels play a crucial role in protecting cells from hypoosmotic shock by opening in response to increased membrane tension, allowing solutes to flow out of the cell and thereby reducing turgor pressure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; Cag_0025; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
mscL
Target Protein Sequence
MSVMKEFKEFAVKGNVVDMAVGIIIGGAFGAIVNNLVSQVILPPLGLLIGGVDFSSLYII LKEGATQAAPYNSLAEATAAGAVTLNYGVFLNSVFSFVIMAFAVFLLVKSINMLRRTEGS KSAVPAPSTTKECPYCLSSVPLKATRCPQCTSELK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It is believed to participate in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.