Recombinant Chlorobium chlorochromatii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its incorporation.
Synonyms
lspA; Cag_1346; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
lspA
Target Protein Sequence
MKLFFSLALFVVAADQFSKYVALRFLRDANQSISIIPNFFSFTYAENRGIAFGLEPAPPA LLLLFTMMISAAVLWYVLRSNNRRLIFLLPFSLILGGGVGNMIDRMVRGYVVDFIYFNLY NGYVGNIYLSLWPIFNIADSAITIGGTMLLLFHRTLFPDDPIA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is lspA significant for bacterial physiology and as an antimicrobial target?

LspA plays a critical role in bacterial physiology through several mechanisms:

  • Essential for lipoprotein processing: The lipoprotein-processing system (Lgt, LspA, and Lnt) is essential in all Gram-negative bacteria analyzed to date, and conditionally essential in many Gram-positive bacteria .

  • Virulence factor processing: Many bacterial virulence factors are lipoproteins or require lipoprotein functions, making lspA important for pathogenesis .

  • Symbiotic relationships: In the case of Chlorobium chlorochromatii, which forms the 'Chlorochromatium aggregatum' consortium with a central β-proteobacterium, proper lipoprotein processing may be crucial for maintaining symbiotic interactions .

LspA represents an attractive antimicrobial target because:

  • It is absent from eukaryotes, reducing off-target effects

  • It is essential for bacterial viability

  • Natural inhibitors (globomycin and myxovirescin) have been identified

  • Its highly conserved active site makes resistance development difficult

What is the recommended protocol for recombinant expression of Chlorobium chlorochromatii lspA?

Based on experimental protocols for similar lspA proteins, the following methodology is recommended:

  • Expression system selection:

    • E. coli is the preferred heterologous host for recombinant expression

    • BL21(DE3) or similar strains deficient in proteases are recommended

  • Construct design:

    • Clone the full-length lspA gene (Cag_1346) into an expression vector with an N-terminal His-tag

    • Include a TEV protease cleavage site if tag removal is desired

    • Codon optimization may improve expression in E. coli

  • Expression conditions:

    • Transform expression plasmid into E. coli

    • Grow cultures at 37°C to OD600 of 0.6-0.8

    • Induce with 0.5 mM IPTG

    • Shift temperature to 18-20°C for overnight expression to enhance proper folding of this membrane protein

  • Cell harvesting and lysis:

    • Harvest cells by centrifugation (6,000×g, 15 min, 4°C)

    • Resuspend in lysis buffer containing 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 10% glycerol, 1 mM PMSF

    • Lyse cells using sonication or high-pressure homogenization

    • Add appropriate detergent (e.g., n-dodecyl-β-D-maltoside at 1%) for membrane protein solubilization

  • Purification strategy:

    • Clarify lysate by centrifugation (20,000×g, 30 min, 4°C)

    • Purify using Ni-NTA affinity chromatography

    • Elute with imidazole gradient (20-500 mM)

    • Further purify by size exclusion chromatography

  • Quality control:

    • Verify purity by SDS-PAGE (>90% purity recommended)

    • Confirm identity by Western blot or mass spectrometry

What are the optimal storage conditions for maintaining lspA activity?

To maintain optimal activity of purified recombinant Chlorobium chlorochromatii lspA, follow these evidence-based storage recommendations:

  • Short-term storage:

    • Store working aliquots at 4°C for up to one week

    • Use Tris/PBS-based buffer containing 6% trehalose, pH 8.0

  • Long-term storage options:

    • Store as lyophilized powder at -20°C/-80°C

    • For liquid storage, add 50% glycerol as cryoprotectant and store at -20°C or -80°C

    • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge vials prior to opening

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for freezing stability

  • Critical considerations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce enzyme activity

    • Use low-binding microcentrifuge tubes to prevent protein loss through adsorption

    • When working with the protein, keep it on ice to minimize degradation

What methodologies can be used to assess lspA enzymatic activity?

Two primary methodologies have been established for assessing lspA activity:

Gel-shift assay using recombinant prolipoprotein substrate

  • Substrate preparation:

    • Express and purify a recombinant prolipoprotein (e.g., inhibitor of cysteine protease, proICP)

    • Verify substrate purity by SDS-PAGE

  • Reaction setup:

    • Prepare reaction buffer (typically phosphate or Tris-based, pH 7.5-8.0)

    • Combine purified lspA enzyme with prolipoprotein substrate

    • Incubate at 37°C for 30-60 minutes

  • Analysis:

    • Resolve reaction products by SDS-PAGE

    • Observe mobility shift between unprocessed and processed lipoprotein

    • Quantify band intensities using densitometry

    • Calculate activity as percentage of substrate processed per unit time

Fluorescence Resonance Energy Transfer (FRET) assay

  • FRET substrate design:

    • Synthesize peptide containing lspA cleavage site flanked by fluorophore-quencher pair

    • Include appropriate fatty acid modifications to mimic natural substrate

  • Assay procedure:

    • Prepare reaction mixture in 96-well format

    • Mix FRET substrate with varying concentrations of enzyme

    • Monitor fluorescence increase over time as cleavage separates fluorophore and quencher

  • Data analysis:

    • Plot reaction velocity versus substrate concentration

    • Determine kinetic parameters using Michaelis-Menten model

    • Calculate Km, Vmax, and enzymatic efficiency (kcat/Km)

For reference, LspA from Staphylococcus aureus showed an apparent Km of 47 μM and Vmax of 2.5 nmol/(mg min), while Pseudomonas aeruginosa LspA exhibited Km of 10 μM and Vmax of 107 nmol/(mg min) . These parameters can serve as benchmarks when evaluating Chlorobium chlorochromatii lspA activity.

How can inhibition studies of lspA be effectively designed and conducted?

To conduct rigorous inhibition studies of Chlorobium chlorochromatii lspA:

Inhibitor selection and preparation

  • Known lspA inhibitors:

    • Globomycin and myxovirescin are well-characterized lspA inhibitors

    • Prepare stock solutions in DMSO or appropriate solvent

    • Create dilution series covering at least 3 orders of magnitude around expected IC50

  • Novel inhibitor candidates:

    • Design based on structural information about lspA active site

    • Consider the 19-atom motif shared between globomycin and myxovirescin

    • Ensure solubility in assay conditions

Inhibition assay methodologies

  • FRET-based inhibition assay:

    • Pre-incubate enzyme with inhibitor for 15-30 minutes

    • Add FRET substrate and monitor reaction progress

    • Include appropriate controls:

      • No enzyme control (0% activity)

      • No inhibitor control (100% activity)

      • Solvent control (DMSO effect)

  • Gel-shift inhibition assay:

    • Pre-incubate enzyme with inhibitor

    • Add prolipoprotein substrate

    • Analyze by SDS-PAGE to quantify inhibition of processing

Data analysis and interpretation

  • IC50 determination:

    • Plot percent inhibition versus log[inhibitor concentration]

    • Fit to four-parameter logistic equation

    • Calculate IC50 value and confidence intervals

  • Mechanism of inhibition:

    • Vary both substrate and inhibitor concentrations

    • Analyze using Lineweaver-Burk or similar plots

    • Determine inhibition type (competitive, non-competitive, etc.)

  • Special considerations for tight-binding inhibitors:

    • If IC50 approaches enzyme concentration, use Morrison equation for tight-binding inhibitors

    • Analyze data considering enzyme concentration in calculations

For reference, when proICP was used as substrate, the IC50 of Pseudomonas aeruginosa LspA for globomycin was 0.64 μM at an enzyme concentration of 0.5 μM, while for Staphylococcus aureus LspA, it was 171 μM at the same enzyme concentration . This illustrates the importance of considering species-specific variations when designing inhibition studies.

How can the conformational dynamics of lspA be studied experimentally?

A hybrid experimental approach combining multiple techniques provides the most comprehensive understanding of lspA conformational dynamics:

Molecular Dynamics (MD) Simulations

  • System preparation:

    • Build homology model of Chlorobium chlorochromatii lspA if crystal structure unavailable

    • Embed protein in lipid bilayer membrane model

    • Solvate system with water and appropriate ions

  • Simulation protocol:

    • Perform energy minimization and equilibration

    • Run multiple production simulations (100-500 ns each)

    • Use enhanced sampling techniques if necessary (metadynamics, replica exchange)

  • Analysis of trajectories:

    • Calculate RMSD and RMSF to identify flexible regions

    • Analyze distances between key structural elements (e.g., periplasmic helix and β-cradle)

    • Identify distinct conformational states using clustering algorithms

Electron Paramagnetic Resonance (EPR) Spectroscopy

  • Site-directed spin labeling:

    • Introduce cysteine residues at strategic positions

    • Label with MTSL or other spin labels

    • Verify labeling efficiency by mass spectrometry

  • Continuous Wave (CW) EPR:

    • Measure nanosecond timescale motions

    • Analyze line shapes to determine mobility parameters

    • Compare experimental spectra with simulated spectra from MD trajectories

  • Double Electron-Electron Resonance (DEER):

    • Measure distances between labeled sites (2-8 nm range)

    • Generate distance distribution profiles

    • Compare with distances predicted from structural models

Integrative Analysis Approach

  • Data integration strategy:

    • Generate ensemble of conformations from MD simulations

    • Filter conformations using experimental EPR constraints

    • Identify populated conformational states

  • Validation steps:

    • Cross-validate structural models against independent experimental data

    • Perform additional simulations to test predictions

Based on this methodology, research has shown that lspA's periplasmic helix fluctuates on the nanosecond timescale, sampling at least three distinct conformations: closed (dominant in apo state), intermediate (stabilized by globomycin), and open (required for substrate binding) . This conformational flexibility explains how lspA accommodates diverse substrates.

How do structural changes in lspA correlate with its catalytic function?

The relationship between lspA structural dynamics and catalytic function can be analyzed using the following framework:

Defining the Key Conformational States

Based on integrated structural analysis, lspA exhibits three primary conformational states that directly impact its function:

  • Closed conformation:

    • Periplasmic helix (PH) and β-cradle are approximately 6.2 Å apart

    • Active site residues are occluded from the lipid bilayer

    • Predominant in the apo state

    • Function: Protects charged catalytic residues from the hydrophobic membrane environment

  • Intermediate conformation:

    • PH is positioned more openly than in the closed state

    • Stabilized by binding of inhibitors like globomycin

    • May represent the clamped substrate-bound state

    • Function: Accommodates bound substrate during catalysis

  • Open conformation:

    • Greatest distance between PH and β-cradle

    • Creates a trigonal cavity for substrate binding

    • Only conformation that can sterically accommodate prolipoprotein substrate

    • Function: Enables substrate entry into the active site

Structure-Function Correlation Methodology

  • Catalytic residue positioning analysis:

    • Track positions of catalytic dyad residues across conformational states

    • Measure distances to substrate/inhibitor binding sites

    • Correlate with enzymatic activity data

  • Substrate binding mode analysis:

    • Dock prolipoprotein substrates into different conformational states

    • Evaluate binding energies and steric constraints

    • Identify key protein-substrate interactions

  • Conformational transition analysis:

    • Calculate energy barriers between conformational states

    • Determine rate-limiting conformational changes

    • Correlate with measured kinetic parameters

Functional Implications

The conformational dynamics of lspA suggest a catalytic mechanism where:

  • The apo enzyme predominantly occupies the closed state, protecting the active site.

  • Substrate approach triggers transition to the open state, allowing substrate entry.

  • Substrate binding induces transition to the intermediate state for optimal catalysis.

  • After catalysis, product release allows return to the closed state.

This model explains how inhibitors like globomycin function by stabilizing the intermediate conformation, preventing both substrate binding (by blocking the open state) and active site protection (by blocking return to the closed state) .

How does Chlorobium chlorochromatii lspA's role in symbiotic relationships inform evolutionary biology?

The function of lspA in Chlorobium chlorochromatii provides unique insights into evolutionary biology, particularly regarding the evolution of symbiotic relationships. To investigate this connection, researchers can employ the following methodological approach:

Comparative Genomic Analysis

  • Identify lspA homologs across bacterial species:

    • Perform protein BLAST searches using Chlorobium chlorochromatii lspA as query

    • Construct phylogenetic trees of lspA sequences

    • Compare evolutionary rates between free-living and symbiotic species

  • Analyze genomic context:

    • Examine gene organization around lspA in different species

    • Identify co-evolved gene clusters

    • Compare with other lipoprotein processing genes (lgt, lnt)

Transcriptomic and Proteomic Profiling

  • Comparative expression analysis:

    • Compare lspA expression between symbiotic and free-living states of Chlorobium chlorochromatii

    • Identify co-regulated genes

    • Correlate with nitrogen metabolism pathways

  • Lipoprotein substrate identification:

    • Perform proteomics to identify lipoproteins processed by lspA

    • Compare lipoprotein profiles between symbiotic and free-living states

    • Identify lipoproteins potentially involved in symbiotic interactions

Functional Characterization in Symbiotic Context

The 'Chlorochromatium aggregatum' consortium provides a model system for understanding how lspA contributes to symbiotic relationships:

  • In this consortium, Chlorobium chlorochromatii (the epibiont) surrounds a central β-proteobacterium .

  • The non-motile Chlorobium provides nitrogen and carbon fixation capabilities.

  • The central β-proteobacterium provides motility, which is fundamental for a phototrophic bacterium .

Research has revealed that in symbiosis, Chlorobium chlorochromatii operates under limited nitrogen conditions where the GS/GOGAT pathway actively assimilates ammonia from N2 fixation. In contrast, when free-living, it exists in nitrogen excess conditions where ammonia is assimilated by the alanine dehydrogenase pathway .

This metabolic shift suggests a profound reorganization of cellular processes during symbiosis, likely involving different sets of lipoproteins processed by lspA. Experimental evidence shows expression of an ABC transporter for amino acids by Chlorobium chlorochromatii only in symbiosis (coded by gene Cag_0853), directly influenced by the β-proteobacterium .

This indicates that lspA may process different lipoproteins under symbiotic versus free-living conditions, contributing to the metabolic adaptations required for symbiosis.

What considerations should guide the design of novel lspA inhibitors as potential antimicrobials?

Designing novel inhibitors targeting lspA requires a systematic approach informed by structural, functional, and pharmacological considerations:

Structure-Based Design Strategy

  • Target the conserved catalytic machinery:

    • Focus on the aspartyl protease catalytic dyad

    • Identify the 19-atom motif shared by known inhibitors (globomycin and myxovirescin)

    • Design transition state analogs that mimic the tetrahedral intermediate

  • Accommodate conformational dynamics:

    • Design inhibitors that can bind to multiple conformational states

    • Consider flexibility of the periplasmic helix in docking studies

    • Create compounds that stabilize non-functional conformations

  • Exploit species-specific differences:

    • Compare active site architectures across pathogenic and non-pathogenic species

    • Identify unique binding pockets in pathogen lspA enzymes

    • Design selective inhibitors targeting pathogen-specific features

Resistance-Hardening Design Principles

  • Target highly conserved residues:

    • Focus on the 14 highly conserved residues surrounding the catalytic site

    • Mutations in these residues would likely impair enzymatic function

    • Design inhibitors that make multiple contacts with conserved residues

  • Engage multiple binding modes:

    • Create inhibitors that can bind in alternative orientations

    • Reduce susceptibility to single point mutations

    • Incorporate flexibility in inhibitor scaffolds

  • Implement multi-target approach:

    • Design dual inhibitors targeting both lspA and other lipoprotein processing enzymes

    • Consider compounds affecting multiple steps in the pathway

    • Reduce probability of resistance development

Pharmacokinetic Optimization

  • Address membrane permeability:

    • Design compounds with appropriate lipophilicity to reach the inner membrane

    • Consider the use of prodrug approaches

    • Optimize charge distribution for membrane interaction

  • Increase metabolic stability:

    • Identify and modify metabolically labile groups

    • Consider incorporation of non-natural amino acids or peptidomimetics

    • Test stability in hepatic microsome assays

  • Reduce toxicity:

    • Assess inhibitor specificity against human aspartyl proteases

    • Evaluate cytotoxicity in mammalian cell lines

    • Perform in silico toxicity predictions

Experimental Validation Framework

  • Enzyme inhibition assays:

    • Measure IC50 values against recombinant lspA from multiple bacterial species

    • Determine mechanism of inhibition

    • Assess tight-binding characteristics

  • Antimicrobial activity testing:

    • Determine minimum inhibitory concentrations (MICs)

    • Test against diverse bacterial pathogens

    • Evaluate activity against resistant strains

  • Resistance development assessment:

    • Perform serial passage experiments to evaluate resistance potential

    • Sequence lspA genes from resistant mutants

    • Assess cross-resistance with other antibiotics

This methodological framework leverages the unique properties of lspA to guide the development of novel antimicrobials with built-in resistance hardiness.

How can big data approaches enhance research on lspA and its interactions?

Modern big data methodologies can significantly advance lspA research through the following strategic approaches:

Implementing Retrospective Experimental Design

  • Dataset preprocessing:

    • Compile heterogeneous data from genomic, structural, and functional studies of lspA

    • Standardize data formats and annotate metadata

    • Address missing values using appropriate imputation methods

  • Subsampling methodology:

    • Apply Algorithm 1 for retrospective designed sampling :

      • Select an initial training sample of data points

      • Determine parameter estimates based on this sample

      • Iteratively optimize the design by selecting data points that maximize utility

      • Update parameter estimates with each new data point

  • Utility function selection:

    • Use observed information matrices to guide sampling

    • For structural data on lspA, utility can be defined as:
      s = det(I(θ|data so far) + I(θ|next observation))

    • This approach ensures efficient sampling of conformational space

Machine Learning Applications

  • Sequence-structure-function prediction:

    • Train neural networks on lspA sequences to predict:

      • Substrate specificity

      • Inhibitor sensitivity

      • Conformational dynamics

  • Virtual screening enhancement:

    • Develop deep learning models to identify potential lspA inhibitors

    • Train on known inhibitor-lspA interactions

    • Implement transfer learning from related aspartyl proteases

  • Molecular dynamics analysis:

    • Apply dimensionality reduction to MD trajectories

    • Identify key collective variables describing lspA motion

    • Use Markov state modeling to map conformational landscape

Comparative Analysis Framework

  • Cross-species comparison:

    • Analyze lspA sequences, structures, and functions across bacterial species

    • Identify conserved and variable regions

    • Correlate with ecological niches and symbiotic relationships

  • Experimental validation strategy:

    • Design targeted experiments to test predictions from big data analysis

    • Implement Bayesian experimental design to maximize information gain

    • Update models iteratively with new experimental data

The power of this approach is demonstrated by comparative studies of lspA kinetics. For example, Staphylococcus aureus LspA shows an apparent Km of 47 μM and Vmax of 2.5 nmol/(mg min), while Pseudomonas aeruginosa LspA exhibits values of 10 μM and 107 nmol/(mg min) . These differences reveal species-specific variations that can be exploited for selective inhibitor design.

What methodologies can resolve contradictory experimental data about lspA function?

Resolving contradictions in experimental data about lspA requires a systematic approach that integrates multiple methodologies:

Root Cause Analysis Framework

  • Identify sources of experimental variability:

    • Expression systems: Different hosts may produce lspA with varying post-translational modifications

    • Purification methods: Detergent choice can affect membrane protein conformation

    • Assay conditions: pH, temperature, and buffer composition impact activity

    • Substrate selection: Different substrates may engage different conformational states

  • Standardization protocol development:

    • Establish reference materials and protocols

    • Create detailed standard operating procedures

    • Implement internal controls for inter-laboratory comparison

  • Statistical analysis for detecting outliers:

    • Apply robust statistical methods resistant to outliers

    • Implement Bayesian approaches to incorporate prior knowledge

    • Use meta-analysis techniques to combine results across studies

Complementary Methodologies Integration

  • Orthogonal technique application:

    • When activity measurements conflict, combine multiple assay types

    • Compare gel-shift and FRET assay results

    • Validate with mass spectrometry of reaction products

  • Structure-function reconciliation:

    • Use structural data to interpret functional contradictions

    • Consider that different conformational states may yield different activity profiles

    • Correlate inhibition patterns with binding modes

  • Time-scale resolution:

    • Differentiate between steady-state and pre-steady-state kinetics

    • Employ stopped-flow or quench-flow techniques for fast reactions

    • Consider the nanosecond timescale conformational dynamics of lspA

Case Study: Resolving Contradictions in Inhibitor Sensitivity

A methodological approach to resolving contradictory inhibitor sensitivity data:

  • Problem statement:

    • For Staphylococcus aureus LspA, the IC50 for globomycin was 171 μM when using proICP as substrate

    • This contradicts the expected tight binding inhibition observed with other lspA enzymes

  • Investigation strategy:

    • Examine assay conditions (detergent concentration, pH, temperature)

    • Consider substrate concentration relative to Km

    • Evaluate enzyme concentration effects on apparent IC50

    • Assess time-dependence of inhibition

  • Resolution approach:

    • Implement multiple substrate concentrations to distinguish competitive vs. non-competitive effects

    • Perform pre-incubation experiments to detect slow-binding inhibition

    • Use molecular dynamics to model species-specific inhibitor interactions

    • Compare results across multiple experimental platforms

By systematically applying these methodologies, researchers can reconcile contradictory data and develop a more comprehensive understanding of lspA function across different species and experimental conditions.

What emerging technologies could revolutionize our understanding of lspA biology?

Several cutting-edge technologies show particular promise for advancing lspA research:

Cryo-Electron Microscopy for Membrane Protein Complexes

  • Implementation strategy:

    • Use latest detergent-free approaches (nanodiscs, amphipols, or SMALPs)

    • Apply time-resolved cryo-EM to capture different conformational states

    • Combine with mass photometry for heterogeneity analysis

  • Expected insights:

    • Structure of apo lspA (currently undetermined)

    • Conformational changes during substrate binding and catalysis

    • Visualization of lspA-substrate complexes

  • Technical challenges:

    • Small size of lspA (approximately 18 kDa) challenges cryo-EM resolution

    • Membrane environment complexity

    • Transient nature of enzyme-substrate interactions

Single-Molecule Biophysics Approaches

  • Advanced FRET methodologies:

    • Implement single-molecule FRET to track conformational changes in real-time

    • Design donor-acceptor pairs at strategic locations

    • Correlate FRET efficiency distributions with functional states

  • Force spectroscopy applications:

    • Use atomic force microscopy to probe mechanical properties

    • Measure energy landscapes of conformational transitions

    • Characterize substrate binding forces

  • Single-particle tracking in native membranes:

    • Monitor lspA dynamics in bacterial membrane environments

    • Measure diffusion coefficients and interaction partners

    • Correlate with cellular function

Advanced Computational Methods

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Model the catalytic mechanism at electronic level

    • Calculate energy barriers for peptide bond cleavage

    • Design transition state analogs as inhibitors

  • Artificial intelligence for conformational analysis:

    • Apply AlphaFold-style approaches to predict conformational ensembles

    • Use reinforcement learning to discover novel binding pockets

    • Develop neural network predictors of substrate specificity

  • Multi-scale simulation methods:

    • Combine atomistic, coarse-grained, and continuum approaches

    • Model lspA function from electronic to cellular scales

    • Predict system-level effects of lspA inhibition

Genome Editing and Synthetic Biology

  • CRISPR-based approaches:

    • Create precise mutations in lspA genes

    • Study effects on bacterial physiology and symbiotic relationships

    • Engineer bacteria with modified lspA specificity

  • Synthetic biology applications:

    • Design minimal lipoprotein processing systems

    • Create orthogonal lipid anchoring mechanisms

    • Develop bacterial strains dependent on engineered lspA variants

These emerging technologies, particularly when applied in combination, could revolutionize our understanding of lspA biology and accelerate the development of novel antimicrobials targeting this essential enzyme.

How might ecological studies of Chlorobium species inform our understanding of lspA evolution?

Ecological approaches provide unique insights into lspA evolution through methodological frameworks that connect molecular mechanisms to environmental adaptation:

Metagenomic Analysis of Diverse Environments

  • Sampling strategy:

    • Target environments where Chlorobium species are prevalent:

      • Anoxic regions of stratified lakes

      • Sulfide-rich springs and marine sediments

      • Microbial mats in thermal features

  • Bioinformatic workflow:

    • Sequence metagenomes using high-throughput platforms

    • Identify lspA homologs using profile hidden Markov models

    • Construct phylogenetic trees of environmental lspA sequences

    • Correlate sequence variants with environmental parameters

  • Functional metagenomics:

    • Clone environmental lspA genes into expression vectors

    • Test activity against diverse substrates

    • Evaluate inhibitor sensitivity profiles

Co-Evolution with Symbiotic Partners

  • Consortium analysis approach:

    • Isolate and characterize natural 'Chlorochromatium aggregatum' consortia from diverse environments

    • Compare lspA sequences between epibionts and their β-proteobacterial partners

    • Identify co-evolved features

  • Experimental testing:

    • Study effects of lspA mutations on consortium formation

    • Identify lipoproteins essential for symbiotic interactions

    • Characterize signal exchange at the molecular level

  • Model-based inference:

    • Apply mathematical models of co-evolution

    • Simulate evolutionary trajectories under different selection pressures

    • Test predictions with experimental data

Adaptive Evolution of Lipoprotein Processing

The unique symbiotic lifestyle of Chlorobium chlorochromatii provides insights into how lspA has adapted to specialized ecological niches:

  • In 'Chlorochromatium aggregatum', metabolic complementarity is evident:

    • The epibiont Chlorobium can perform nitrogen and carbon fixation

    • The consortium shows a metabolic shift in nitrogen metabolism with the GS/GOGAT pathway active in symbiosis vs. the AlaDH pathway in free-living state

  • Proposed evolutionary trajectory:

    • The consortium likely originated from a parasitic interaction

    • N2 fixation capacity of Chlorobium would be enhanced by injection of 2-oxoglutarate from the β-proteobacterium via the periplasm

    • This relationship evolved into a mutualistic symbiosis with complementary advantages

  • Role of lspA in this evolution:

    • Lipoproteins processed by lspA likely facilitate nutrient exchange

    • ABC transporters expressed only in symbiosis (e.g., gene Cag_0853) may require lspA processing

    • Changes in lspA substrate specificity may have co-evolved with symbiotic adaptations

This ecological perspective reveals how lspA function has been shaped by specific symbiotic interactions and environmental conditions, providing insights that purely molecular or structural studies would miss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.