Recombinant Chlorobium chlorochromatii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Cag_0634; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
nuoA
Target Protein Sequence
MDQTLTQFGSVFVFLLLGVIFVVGGYLTSRLLRPSRPNPQKNSTYECGEEAIGSAWVKFN IRFYVVALIFIIFDVEVVFLYPWATVFKPLGTFALIEVLVFAGILILGLAYAWVKGDLDW VRPTPNIPKMPPMPELPVAKGASQKD
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This process couples redox reactions with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) in Chlorobium species?

NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NADH dehydrogenase I complex in Chlorobium species, including Chlorobium chlorochromatii. In related species like Chlorobium phaeobacteroides, nuoA is a relatively small protein (143 amino acids) with a predominantly hydrophobic sequence that facilitates its integration into the cell membrane . It plays a crucial role in electron transport processes, particularly in anoxygenic photosynthesis where green sulfur bacteria use sulfide as electron donors rather than water .

How does nuoA function in the electron transport chain of Chlorobium species?

NuoA functions as part of the NADH dehydrogenase I complex (also called NDH-1 or Complex I), which is essential for energy metabolism in Chlorobium species. The protein contributes to the proton-pumping activity of the complex, helping to establish the proton motive force necessary for ATP synthesis. In Chlorobium chlorochromatii and related species, this function is particularly important during anoxygenic photosynthesis, where the bacterium uses sulfide as an electron donor for photosynthetic reactions . The membrane-spanning regions of nuoA (evident from its amino acid sequence) are critical for this function .

What is the relationship between nuoA and nitrogen metabolism in Chlorobium chlorochromatii?

While nuoA itself is not directly involved in nitrogen metabolism, the energy generated through the electron transport chain (where nuoA functions) provides the ATP necessary for nitrogen fixation and assimilation processes. In Chlorobium chlorochromatii, nitrogen metabolism shows significant differences between symbiotic and free-living states. In symbiosis, the bacterium experiences nitrogen-limited conditions and primarily uses the GS/GOGAT (glutamine synthetase/glutamate synthetase) pathway for ammonia assimilation. In contrast, under free-living conditions with excess nitrogen, it preferentially uses the alanine dehydrogenase (AlaDH) pathway . The energy for these nitrogen metabolism pathways is supplied in part by the electron transport chain containing nuoA.

How does the expression of nuoA differ between symbiotic and free-living states?

Based on transcriptomic and proteomic studies of Chlorobium chlorochromatii CaD3, numerous genes show differential expression patterns between symbiotic and free-living states. While nuoA specifically was not highlighted in the available research, approximately 350 genes in C. chlorochromatii have different expression patterns between these two states . Many of these differentially expressed genes are involved in nitrogen and amino acid metabolism, suggesting that energy metabolism genes (potentially including nuoA) might also be regulated differently depending on the symbiotic status of the bacterium.

How does nuoA contribute to the symbiotic relationship in 'Chlorochromatium aggregatum'?

In 'Chlorochromatium aggregatum', the consortium formed by Chlorobium chlorochromatii CaD3 (the epibiont) and a central β-proteobacterium, energy metabolism is likely critical to maintaining the symbiotic relationship. The nuoA subunit, as part of the NADH dehydrogenase complex, contributes to energy generation that supports both carbon and nitrogen fixation in the Chlorobium partner . This energy production is particularly important in the symbiotic state where C. chlorochromatii experiences nitrogen limitation and must fix atmospheric nitrogen, a highly energy-demanding process. The photosynthetic activity of C. chlorochromatii, supported by the electron transport chain containing nuoA, provides energy benefits to the consortium as a whole, while the β-proteobacterium contributes motility and potentially provides metabolites like 2-oxoglutarate .

What structural features of nuoA are critical for its function in the NADH dehydrogenase complex?

Based on the amino acid sequence of nuoA in Chlorobium phaeobacteroides (similar to C. chlorochromatii), several structural features appear critical for its function:

  • Hydrophobic transmembrane domains: The sequence "VFAFLALGIVFVAGGY" and other hydrophobic regions suggest multiple membrane-spanning domains that anchor the protein in the membrane .

  • Conserved charged residues: Charged amino acids like glutamic acid (E) and arginine (R) in specific positions likely participate in proton translocation or protein-protein interactions within the complex.

  • Terminal regions: The C-terminal "DRKAEGGRA" sequence contains charged residues that may be involved in interactions with other subunits of the complex .

Understanding these structural features is essential for interpreting how mutations might affect the function of the entire NADH dehydrogenase complex.

What insights can comparative genomics provide about nuoA evolution in green sulfur bacteria?

Comparative genomics approaches can reveal important aspects of nuoA evolution in green sulfur bacteria like Chlorobium species. The study of orthologous proteins between C. chlorochromatii CaD3, C. tepidum, and other Chlorobia species has been used to improve metabolic reconstructions . Similar approaches could be applied specifically to nuoA to:

  • Identify conserved domains that are essential for function across all Chlorobia

  • Detect lineage-specific adaptations in nuoA that might correlate with different ecological niches

  • Understand the co-evolution of nuoA with other NADH dehydrogenase subunits

  • Reveal potential horizontal gene transfer events involving nuoA

This evolutionary perspective can provide insights into why nuoA has specific structural features in C. chlorochromatii compared to related bacteria.

How might nuoA interact with the unique metabolic pathways of Chlorobium chlorochromatii?

NuoA, as part of the NADH dehydrogenase complex, likely interacts with several unique metabolic pathways in C. chlorochromatii:

  • Reverse TCA cycle: Unlike most organisms, green sulfur bacteria use the reverse TCA cycle for carbon fixation. This pathway generates different ratios of reducing equivalents compared to the Calvin cycle, potentially affecting substrate availability for the NADH dehydrogenase complex containing nuoA .

  • Sulfide oxidation: C. chlorochromatii uses sulfide as an electron donor for anoxygenic photosynthesis. The electrons from sulfide oxidation enter the electron transport chain, potentially interacting with the NADH dehydrogenase complex .

  • Nitrogen fixation: Under symbiotic conditions, C. chlorochromatii has high rates of nitrogen fixation, which requires significant energy input. The electron transport chain containing nuoA would provide ATP for this process .

What are the optimal conditions for expressing recombinant Chlorobium nuoA in E. coli systems?

Based on existing protocols for recombinant nuoA from Chlorobium phaeobacteroides, the following conditions are recommended for expression in E. coli systems:

  • Expression system: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) should be considered due to the membrane-associated nature of nuoA .

  • Fusion tags: An N-terminal His-tag has been successfully used for purification of recombinant nuoA from C. phaeobacteroides and would likely work for C. chlorochromatii nuoA as well .

  • Induction conditions: Moderate induction conditions (lower IPTG concentrations, 18-25°C post-induction) are typically better for membrane proteins to prevent inclusion body formation.

  • Media supplements: Addition of rare codons tRNA supplement may improve expression if codon usage differs significantly between Chlorobium and E. coli.

What purification strategies are most effective for recombinant nuoA protein?

For the purification of recombinant nuoA protein from Chlorobium species, the following strategy can be effective:

  • Affinity chromatography: Using Ni-NTA resin to capture the His-tagged nuoA protein is the primary purification step .

  • Membrane solubilization: Proper detergent selection (such as n-dodecyl-β-D-maltoside or CHAPS) is critical for extracting nuoA from membranes without denaturing it.

  • Buffer conditions: Tris/PBS-based buffers with pH around 8.0 have been successful for nuoA from C. phaeobacteroides .

  • Storage: Addition of approximately 50% glycerol in the final storage buffer helps maintain protein stability during freeze-thaw cycles .

  • Final form: Lyophilization can be used to prepare a stable powder form of the protein, which can be reconstituted to a concentration of 0.1-1.0 mg/mL in deionized sterile water .

What analytical techniques are most suitable for characterizing nuoA structure and function?

Several analytical techniques are particularly valuable for characterizing the structure and function of nuoA:

  • Circular Dichroism (CD) spectroscopy: To analyze secondary structure content and confirm proper folding of the recombinant protein.

  • NADH oxidation assays: To measure the enzymatic activity of reconstituted NADH dehydrogenase complexes containing nuoA.

  • Blue Native PAGE: To analyze the integration of nuoA into the complete NADH dehydrogenase complex.

  • Cryo-electron microscopy: For structural determination of nuoA within the context of the entire NADH dehydrogenase complex.

  • Proteoliposome reconstitution: To study proton pumping activity in a membrane environment that mimics the native bacterial membrane.

How can researchers design experiments to study nuoA in the context of symbiotic relationships?

To study nuoA in the context of the symbiotic relationship in 'Chlorochromatium aggregatum', researchers should consider:

  • Co-culture systems: Establishing laboratory conditions that maintain the consortium of C. chlorochromatii and its β-proteobacterial partner, noting that 2-oxoglutarate supplementation appears necessary for consortium growth .

  • Controlled separation experiments: Techniques to temporarily separate the partners and observe changes in nuoA expression or activity upon re-association.

  • Transcriptomic analysis: RNA-seq to examine differential expression of nuoA and related genes between symbiotic and free-living states, similar to previous studies that identified approximately 350 differentially expressed genes .

  • Metabolic labeling: Use of isotope-labeled compounds (particularly nitrogen sources) to track metabolic exchanges between symbionts and their impact on energy metabolism.

  • Genetic modification: Development of gene replacement or knockout systems specifically targeting nuoA to observe effects on the symbiotic relationship.

What are the key considerations for storing and handling recombinant nuoA protein?

Based on protocols for similar recombinant proteins, the following considerations are important for storing and handling nuoA protein:

  • Storage temperature: Store at -20°C/-80°C for long-term storage, with working aliquots kept at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided, necessitating preparation of single-use aliquots .

  • Buffer composition: Tris/PBS-based buffer containing approximately 6% trehalose at pH 8.0 has been effective for maintaining stability .

  • Reconstitution: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Adding glycerol to a final concentration of 50% helps prevent damage from freeze-thaw cycles .

How should researchers interpret changes in nuoA expression patterns between symbiotic and free-living states?

When analyzing changes in nuoA expression between symbiotic and free-living states of C. chlorochromatii, researchers should consider:

What standard controls should be included in experiments studying recombinant nuoA?

Robust experimental design for studying recombinant nuoA should include:

  • Empty vector controls: E. coli transformed with expression vector lacking the nuoA gene to control for effects of the expression system itself.

  • Related protein controls: Expression of other NADH dehydrogenase subunits or related membrane proteins to distinguish nuoA-specific effects from general effects of membrane protein overexpression.

  • Activity controls: Known inhibitors of NADH dehydrogenase (such as rotenone or piericidin A) to validate functional assays.

  • Protein quality controls: SDS-PAGE and Western blotting to confirm protein size, purity (>90% is typically considered acceptable), and expected immunoreactivity .

  • Negative controls for symbiosis experiments: Free-living C. chlorochromatii under various nutrient conditions to distinguish symbiosis-specific effects from general nutrient responses.

How can ElementaryFlux Mode analysis contribute to understanding nuoA function in metabolic networks?

Elementary Flux Mode (EFM) analysis, as demonstrated in studies of C. chlorochromatii metabolism, can provide valuable insights into nuoA function within the broader metabolic network:

What bioinformatic approaches can predict functional residues in nuoA proteins?

Several bioinformatic approaches can help identify functional residues in nuoA:

  • Multiple sequence alignment: Aligning nuoA sequences from diverse Chlorobium species can identify highly conserved residues likely to be functionally important.

  • Structure prediction: Using tools like AlphaFold to predict the 3D structure of nuoA can help identify residues in potential functional sites.

  • Co-evolution analysis: Identifying residues that show correlated mutations across species can reveal amino acids that interact functionally.

  • Domain prediction: Tools like HMMER3 against the Pfam database can identify conserved domains with known functions .

  • Molecular dynamics simulations: Simulating the behavior of nuoA in a membrane environment can predict residues involved in proton translocation or structural stability.

How can researchers integrate nuoA-specific data into whole-organism metabolic models?

To integrate nuoA-specific data into whole-organism metabolic models of C. chlorochromatii:

  • Flux constraints: Experimental measurements of NADH dehydrogenase activity can be used to constrain flux through the corresponding reactions in genome-scale metabolic models.

  • Gene-protein-reaction associations: Clearly defining the relationship between the nuoA gene, its protein product, and the specific reactions it catalyzes ensures proper integration into models .

  • Condition-specific parameters: Different parameters may need to be used for symbiotic versus free-living states, reflecting the observed metabolic differences .

  • Integration with other datasets: Combining nuoA-specific data with transcriptomic, proteomic, and metabolomic datasets provides a more comprehensive view of metabolism.

  • Model validation: Predictions from models incorporating nuoA data should be validated against experimental measurements of growth rates, metabolite concentrations, or other phenotypic characteristics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.