Recombinant Chlorobium chlorochromatii Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant CrcB homolog is a fluoride ion transporter homolog produced via heterologous expression in Escherichia coli. Key features include:

PropertyDetails
Species OriginChlorobium chlorochromatii (strain CaD3)
UniProt IDQ3AUE0
Recombinant ExpressionFull-length protein (1-129 amino acids) fused to an N-terminal His tag
Molecular Weight~14.8 kDa (calculated)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Amino Acid Sequence

The 129-residue sequence is:
MVDKAAHILLVGVGGFLGSVARYLVALWMAPITAVFPFATLTVNLLGSFLIGFISELALSTSLISPSTRIFLVTGFCGGFTTFSSYMIEHSALLRDGEHLYAALYLFGSLIGGFIALYLGIISARWMAG

Domain Architecture

  • Predicted Function: Putative fluoride ion transporter, inferred from homology to Clostridium perfringens CrcB .

  • Structural Motifs: Contains hydrophobic regions consistent with transmembrane helices, suggesting membrane localization .

Genomic Context

  • Encoded by the crcB gene (locus tag: Cag_0012) in Chlorobium chlorochromatii .

  • Homologs identified across Chlorobi, Proteobacteria, and Archaea, indicating evolutionary conservation in fluoride transport .

Experimental Use Cases

  • Ion Transport Studies: Investigated for fluoride efflux capabilities in bacterial stress response mechanisms .

  • Structural Biology: Serves as a template for cryo-EM or X-ray crystallography to resolve transporter architecture .

  • Symbiosis Research: Chlorobium chlorochromatii is a model for syntrophic consortia; CrcB may contribute to nitrogen or metabolite exchange in symbiotic systems .

Metabolic Role in Chlorobium chlorochromatii

  • Nitrogen Assimilation: Under symbiotic conditions, C. chlorochromatii upregulates nitrogen fixation pathways (e.g., GS/GOGAT), where CrcB might facilitate ion homeostasis during ammonia assimilation .

  • Genomic Adaptations: The crcB gene resides in a genomic island (EP_GI-1) encoding adhesins and transporters critical for consortium formation .

Homolog Studies

  • Clostridium perfringens CrcB (UniProt: Q8XLL2) shares 32% sequence identity, highlighting conserved residues in transmembrane regions .

  • In Chlorobaculum tepidum, CrcB homologs are co-localized with sulfur oxidation genes, suggesting a role in coupling ion transport to phototrophic metabolism .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Important: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; Cag_0012; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Chlorobium chlorochromatii (strain CaD3)
Target Names
crcB
Target Protein Sequence
MVDKAAHILLVGVGGFLGSVARYLVALWMAPITAVFPFATLTVNLLGSFLIGFISELALS TSLISPSTRIFLVTGFCGGFTTFSSYMIEHSALLRDGEHLYAALYLFGSLIGGFIALYLG IISARWMAG
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within cells, thereby minimizing its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Chlorobium chlorochromatii Protein CrcB homolog and what is its putative function?

The crcB homolog in Chlorobium chlorochromatii is part of a protein family found across numerous bacterial species, including the well-studied green sulfur bacteria. Based on comparative genomic analyses, crcB is hypothesized to function in ion transport across cell membranes, particularly in fluoride ion transport. In green sulfur bacteria like Chlorobaculum tepidum, homologous membrane proteins often play crucial roles in maintaining cellular homeostasis under changing environmental conditions . The protein likely contains multiple transmembrane domains that form channels for ion passage, similar to other members of the crcB protein family.

How should researchers approach expression system selection for recombinant crcB production?

When selecting an expression system for recombinant crcB production, researchers should consider several factors. First, evaluate whether prokaryotic (E. coli) or eukaryotic systems will better preserve the protein's native conformation. Since crcB is likely a membrane protein, systems designed for membrane protein expression (such as C41/C43 E. coli strains) may yield better results. Alternatively, cell-free expression systems can be advantageous for toxic membrane proteins. Researchers should test multiple expression vectors with varying promoter strengths and fusion tags (His, MBP, or GST) to optimize yield and solubility . Expression temperature, inducer concentration, and duration should be systematically tested using small-scale cultures before scaling up production.

What purification strategies are most effective for recombinant crcB protein?

Purification of recombinant crcB requires specialized approaches due to its likely membrane-associated nature. The most effective strategy typically involves:

  • Membrane fraction isolation using ultracentrifugation

  • Solubilization with appropriate detergents (test LDAO, DDM, and OG at various concentrations)

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography for final purification

For optimal results, researchers should perform thermal stability assays with different buffer compositions to identify conditions that maximize protein stability. When working with green sulfur bacterial proteins like those from Chlorobium species, maintaining anaerobic conditions during purification may be critical for preserving native structure and function . Verify protein purity using SDS-PAGE and Western blotting with antibodies against the fusion tag or the protein itself if available.

How can researchers verify the structural integrity of purified recombinant crcB?

To verify structural integrity of purified recombinant crcB, employ multiple biophysical techniques:

TechniqueInformation ProvidedSample Requirements
Circular Dichroism (CD)Secondary structure composition0.1-0.5 mg/ml protein in low-salt buffer
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)Oligomeric state and homogeneity1-2 mg protein
Differential Scanning Fluorimetry (DSF)Thermal stability under various conditions0.1 mg/ml protein with fluorescent dye
Limited ProteolysisDomain organization and flexible regions0.5-1 mg protein with various proteases

Since membrane proteins like crcB can be challenging to characterize, consider cryogenic electron microscopy (cryo-EM) for structural determination if sufficient quantities of stable, homogeneous protein can be obtained. For functional verification, develop ion transport assays in proteoliposomes or planar lipid bilayers to test the protein's predicted activity .

How can RNA-seq approaches be optimized to study crcB expression under different environmental conditions?

To optimize RNA-seq approaches for studying crcB expression, researchers should design experiments that capture differential expression under relevant environmental conditions. Based on studies of sulfur metabolism in related green sulfur bacteria, consider testing conditions that alter cellular ion homeostasis or membrane integrity. For example, vary external concentrations of fluoride, chloride, or other ions that might be transported by crcB.

When designing RNA-seq experiments:

  • Include at least 3-4 biological replicates per condition to enable robust statistical analysis

  • Target sequencing depth of >20 million reads per sample for adequate coverage

  • Include spike-in controls for normalization

  • Develop a time-course sampling strategy to capture early and late transcriptional responses

For data analysis, use established pipelines like DESeq2 or edgeR to identify differentially expressed genes. Consider crcB expression in the context of coexpressed gene clusters to identify potential operonic structures, as demonstrated in the study of sulfur oxidation genes in C. tepidum where RNA-seq revealed coordinated expression of functionally related genes . This approach will help position crcB within its broader regulatory network.

What approaches should be used to resolve contradictions in crcB functional data across different experimental systems?

When confronting contradictory functional data for crcB across different experimental systems, researchers should implement a systematic troubleshooting approach:

  • Conduct a meta-analysis of all available data, cataloging experimental variables (expression system, purification methods, assay conditions)

  • Test protein activity across a matrix of conditions (pH, temperature, ion concentrations)

  • Verify protein folding and stability in each experimental system using biophysical methods

  • Consider native vs. recombinant protein comparison studies

  • Develop complementary in vivo and in vitro assays to triangulate function

In cases of persistent contradictions, consider the possibility that crcB may have context-dependent functions. As observed with SQR proteins in C. tepidum, which showed condition-specific expression patterns, crcB may have different roles depending on environmental context . Generate knockout or knockdown strains coupled with phenotypic assays under varying conditions to identify the biological consequences of crcB absence.

How can researchers design experiments to elucidate the transcriptional regulation of crcB?

To elucidate transcriptional regulation of crcB, researchers should implement a multi-faceted experimental approach:

  • Promoter Mapping: Use 5' RACE (Rapid Amplification of cDNA Ends) to identify transcription start sites and promoter regions.

  • Transcription Factor Identification: Employ DNA affinity chromatography using the crcB promoter region as bait, followed by mass spectrometry to identify bound proteins.

  • Reporter Assays: Construct promoter-reporter fusions with varying lengths of the upstream region to identify critical regulatory elements.

  • ChIP-seq: If candidate transcription factors are identified, perform chromatin immunoprecipitation sequencing to map genome-wide binding profiles.

  • Comparative Genomics: Analyze promoter conservation across related species to identify conserved regulatory motifs.

RNA-seq data from C. tepidum revealed that transcription of certain genes (like CT1276 and CT1277) changes dramatically in response to environmental stimuli such as sulfide addition . Similar approaches could be used to identify conditions that alter crcB expression. When analyzing such data, look for co-regulated genes that might share regulatory mechanisms with crcB, as this could reveal functional associations.

What are the most rigorous approaches to characterize the ion selectivity and transport mechanisms of crcB?

To rigorously characterize ion selectivity and transport mechanisms of crcB, implement the following methodological approaches:

ApproachMethodologyAdvantagesLimitations
Proteoliposome Flux AssaysReconstitute purified crcB in liposomes with ion-sensitive fluorescent dyesDirect measurement of transport activityComplex preparation, potential artifacts
Planar Lipid Bilayer ElectrophysiologySingle-channel recordings of crcB in artificial membranesSingle-molecule resolution of transport eventsTechnical difficulty, low throughput
Isothermal Titration Calorimetry (ITC)Measure binding affinities for different ionsQuantitative binding constantsDoesn't directly measure transport
Structure-guided MutagenesisSystematic mutation of putative ion-binding residuesLinks structure to functionRequires structural information
Cellular Ion AccumulationMeasure ion content in cells expressing wild-type vs. mutant crcBPhysiological relevanceIndirect measurement

When designing these experiments, it's critical to include appropriate controls, such as inactive mutants and empty liposomes. To determine transport mechanism (channel vs. transporter), measure ion flux rates at different concentrations and membrane potentials. Compare results across multiple experimental systems to ensure robustness. The approach used to characterize sulfide:quinone oxidoreductase (SQR) activities in C. tepidum, combining in vitro biochemical assays with in vivo functional studies, provides a useful methodological template .

What experimental design approaches are most appropriate for studying crcB function in different genetic backgrounds?

When studying crcB function across different genetic backgrounds, researchers should implement robust experimental designs that control for confounding variables while maximizing inferential power. Consider a mixed factorial design where genetic background serves as one factor and environmental conditions as another. This approach allows for detection of both main effects and interaction effects.

Key experimental design considerations include:

  • Control Selection: Include both positive controls (well-characterized ion transport proteins) and negative controls (inactive mutants).

  • Randomization: Randomize the order of experiments to distribute any uncontrolled variables.

  • Blocking: Group experiments by potentially confounding variables like batch effects.

  • Sample Size Calculation: Perform power analysis based on preliminary data to determine appropriate sample sizes.

  • Preregistration: Consider preregistering experimental protocols to enhance transparency.

For genetic manipulation, employ precise genome editing techniques like CRISPR-Cas9 rather than random mutagenesis to avoid off-target effects. When comparing across genetic backgrounds, ensure that expression levels of crcB are comparable, perhaps by using controlled promoters or quantitative Western blotting . This systematic approach will strengthen causal inferences about crcB function.

How should researchers design experiments to distinguish between direct and indirect effects of crcB on cellular physiology?

To distinguish between direct and indirect effects of crcB on cellular physiology, researchers need to implement experimental designs that establish causality through multiple lines of evidence:

  • Time-Course Experiments: Monitor cellular responses at multiple time points following crcB induction or deletion. Immediate effects are more likely to be direct, while delayed effects may be indirect.

  • Dose-Response Relationships: Vary crcB expression levels using inducible promoters and correlate with physiological outcomes.

  • Separation of Function Mutations: Generate crcB variants that affect specific activities to determine which functions are responsible for which phenotypes.

  • Epistasis Analysis: Combine crcB mutations with mutations in potential interacting pathways to identify genetic interactions.

  • Biochemical Reconstitution: Purify crcB and potential interacting components to reconstitute activities in vitro.

RNA-seq approaches, similar to those used in C. tepidum studies, can identify immediate transcriptional responses to crcB manipulation, helping distinguish primary from secondary effects . Additionally, metabolomic and proteomic analyses can provide complementary data on cellular physiological changes, creating a comprehensive picture of crcB's impact on cellular networks.

What considerations are important when designing site-directed mutagenesis experiments for crcB functional studies?

When designing site-directed mutagenesis experiments for crcB functional studies, researchers should consider:

  • Rational Selection of Mutation Sites:

    • Conserved residues identified through multiple sequence alignments

    • Predicted functional regions based on structural models

    • Charged residues potentially involved in ion coordination

    • Regions showing altered evolutionary rates

  • Mutation Strategy:

    • Conservative substitutions to test specific chemical properties

    • Charge-reversal mutations for ion-binding sites

    • Cysteine-scanning mutagenesis for accessibility studies

    • Alanine-scanning for systematic functional mapping

  • Control Mutations:

    • Include mutations in non-conserved regions as controls

    • Create both loss-of-function and gain-of-function mutations when possible

  • Validation Approaches:

    • Verify protein expression levels by Western blotting

    • Confirm proper membrane localization via fractionation or imaging

    • Check protein folding using limited proteolysis or thermal shift assays

  • Functional Assays:

    • Test multiple functions including ion transport, protein interactions, and cellular phenotypes

    • Employ both in vitro and in vivo assays to cross-validate findings

Similar site-directed mutagenesis approaches were successful in characterizing the sulfide:quinone oxidoreductase in C. tepidum, where specific residues critical for function were identified . Maintain detailed documentation of all mutations, their rationales, and phenotypic consequences to build a comprehensive structure-function map of crcB.

How should researchers approach contradictory results in crcB functional characterization studies?

When confronted with contradictory results in crcB functional characterization, researchers should implement a systematic troubleshooting and analytical approach:

  • Methodological Cross-Comparison: Create a detailed matrix comparing experimental conditions, reagents, and protocols across studies. Small differences in buffer composition, temperature, or protein preparation can dramatically affect membrane protein function.

  • Parameter Space Exploration: Systematically vary experimental parameters to identify conditions that reconcile contradictory results. This approach proved valuable in C. tepidum studies where sulfide and thiosulfate concentrations significantly impacted gene expression patterns .

  • Multiple Technique Validation: Employ orthogonal techniques to validate findings. For example, if ion transport results differ between electrophysiology and fluorescence-based assays, add isotope flux studies as a third approach.

  • Developmental and Environmental Context: Consider whether crcB function varies with growth phase or environmental conditions, similar to how sulfide:quinone oxidoreductase genes in C. tepidum show condition-dependent expression .

  • Statistical Reassessment: Perform meta-analysis of available data, potentially revealing patterns obscured in individual studies.

  • Functional Redundancy: Investigate whether parallel systems compensate for crcB, potentially masking phenotypes in certain conditions.

Researchers should maintain transparency about contradictory results in publications rather than selectively reporting supportive data, as understanding the full range of protein behavior is essential for complete functional characterization.

What statistical approaches are most appropriate for analyzing crcB expression data across different environmental conditions?

For analyzing crcB expression data across environmental conditions, researchers should select statistical approaches based on experimental design and data characteristics:

  • Differential Expression Analysis:

    • For RNA-seq data: DESeq2, edgeR, or limma-voom packages, which handle count data with appropriate variance modeling

    • For qRT-PCR: ANOVA with post-hoc tests for multiple conditions, or t-tests for pairwise comparisons with appropriate multiple testing correction

  • Time Series Analysis:

    • EDGE (Extraction of Differential Gene Expression) for time course experiments

    • Functional data analysis to model expression trajectories

    • Hidden Markov Models to identify state transitions in expression

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Weighted Gene Co-expression Network Analysis (WGCNA) to identify co-regulated gene modules

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify condition-specific expression patterns

  • Robust Analysis Methods:

    • Permutation tests for hypothesis testing without distributional assumptions

    • Bootstrap resampling to estimate confidence intervals

    • Bayesian approaches for incorporating prior knowledge

When analyzing crcB expression, consider the methods employed in C. tepidum studies, where they identified significantly changed genes using a false discovery rate (FDR) threshold of 0.05 and a fold-change cutoff . Additionally, cluster genes by expression patterns to identify coordinately regulated processes, which may reveal functional relationships between crcB and other genes.

What approaches should be used to integrate transcriptomic, proteomic, and functional data for comprehensive characterization of crcB?

To integrate multi-omics data for comprehensive crcB characterization, researchers should employ systematic data integration strategies:

  • Correlation-based Integration:

    • Calculate correlation coefficients between transcript levels, protein abundance, and functional measurements

    • Identify concordant and discordant patterns that may reveal post-transcriptional regulation

  • Network-based Integration:

    • Construct gene/protein interaction networks incorporating crcB

    • Use algorithms like WGCNA to identify modules of co-regulated genes

    • Apply Bayesian network approaches to infer causal relationships

  • Multi-omics Factor Analysis:

    • Apply MOFA (Multi-Omics Factor Analysis) to identify major factors of variation across datasets

    • Use DIABLO (Data Integration Analysis for Biomarker discovery using Latent cOmponents) for supervised integration

  • Visualization Techniques:

    • Employ Circos plots to visualize relationships across multiple data types

    • Create multi-layer heatmaps aligning transcriptomic, proteomic, and functional data

  • Time-resolved Integration:

    • Analyze temporal relationships between transcript and protein changes

    • Model delay parameters between transcriptional changes and functional outcomes

The C. tepidum study demonstrated the value of integrating transcriptomic data with physiological measurements, revealing connections between gene expression changes and metabolic shifts in response to environmental perturbations . Similarly, researchers should track environmental conditions, crcB expression, protein levels, and functional outcomes simultaneously to establish causal relationships and regulatory mechanisms.

What are the key considerations for designing primers for crcB amplification and cloning?

When designing primers for crcB amplification and cloning, researchers should consider several critical factors:

  • Sequence Verification and Analysis:

    • Obtain the complete genomic sequence of Chlorobium chlorochromatii

    • Identify the precise crcB coding sequence and analyze for secondary structures

    • Check for potential internal priming sites or repetitive regions

  • Primer Design Parameters:

    • Maintain GC content between 40-60%

    • Aim for melting temperatures of 58-62°C with minimal difference between paired primers

    • Include 18-25 nucleotides of gene-specific sequence

    • Avoid sequences prone to forming secondary structures or primer-dimers

    • Check for specificity against the entire genome using in silico PCR tools

  • Cloning Strategy Elements:

    • Add appropriate restriction sites with 3-6 base flanking sequences

    • Consider protein fusion tags and protease cleavage sites

    • Include Kozak sequences for eukaryotic expression or ribosome binding sites for prokaryotic systems

    • For directional cloning, use different restriction sites at 5' and 3' ends

  • Expression Optimization:

    • Consider codon optimization for the expression host

    • Remove problematic sequences (e.g., cryptic splice sites, internal ribosome binding sites)

    • For membrane proteins like crcB, consider adding sequences for topology analysis

Similar approaches for primer design were likely used in the C. tepidum studies for gene amplification and expression analysis . Always validate primers using in silico tools before synthesis and verify PCR products by sequencing before proceeding to cloning steps.

How can researchers troubleshoot issues with recombinant crcB expression and solubility?

Troubleshooting recombinant crcB expression and solubility requires a systematic approach to identify and overcome bottlenecks:

IssuePotential CausesTroubleshooting Approaches
Low expressionCodon bias, toxicity, mRNA instabilityTry codon optimization, use tightly controlled inducible systems, reduce expression temperature
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-20°C), use solubility-enhancing fusion tags (SUMO, MBP), co-express chaperones
Membrane protein aggregationInsufficient membrane capacity, improper insertionUse specialized strains (C41/C43), tune expression levels, add membrane-fluidizing agents
Proteolytic degradationRecognition by host proteasesAdd protease inhibitors, use protease-deficient strains, optimize extraction conditions
Poor extraction efficiencyTight membrane associationTest different detergents (DDM, LDAO, OG) in concentration gradients, use stronger solubilization buffers

When working with crcB as a potential membrane protein, specific approaches include:

  • Screen multiple detergents at varying concentrations for optimal solubilization

  • Test extraction with varying salt concentrations (100-500 mM)

  • Optimize pH conditions for stability (typically pH 7.0-8.5)

  • Add stabilizing agents like glycerol (5-20%) or specific lipids

  • Consider amphipol or nanodisc technologies for maintaining native-like environment

The approaches used for membrane protein isolation in green sulfur bacteria studies provide a useful reference, as they often deal with similar challenges in maintaining protein stability and function .

What are the most effective approaches for developing specific antibodies against crcB for detection and localization studies?

Developing specific antibodies against crcB requires strategic planning and multiple validation steps:

  • Antigen Design Strategies:

    • Full-length protein approach: Express and purify entire crcB (challenging for membrane proteins)

    • Peptide approach: Identify unique, surface-exposed regions (typically 12-20 amino acids)

    • Multiple epitope approach: Target 2-3 different regions to increase success probability

    • Consider hydrophilicity, accessibility, and antigenicity predictions for epitope selection

    • For membrane proteins like crcB, focus on extramembrane loops or termini

  • Production Methods:

    • Polyclonal antibodies: Faster production, recognize multiple epitopes, but less specific

    • Monoclonal antibodies: Higher specificity, consistent production, but more resource-intensive

    • Recombinant antibodies: Consider nanobodies or single-chain antibodies for membrane proteins

  • Validation Requirements:

    • Western blot against recombinant protein and native samples

    • Immunoprecipitation to confirm specificity

    • Immunofluorescence microscopy with appropriate controls

    • Preabsorption controls with immunizing antigen

    • Testing in knockout/knockdown systems as negative controls

  • Application-specific Considerations:

    • For ELISA: Test antibody performance in different buffer conditions

    • For immunohistochemistry: Validate fixation compatibility

    • For super-resolution microscopy: Validate epitope accessibility in different sample preparations

Researchers studying membrane proteins in green sulfur bacteria have successfully used custom antibodies for protein detection and localization, demonstrating the feasibility of this approach despite the challenges inherent to membrane proteins .

What are the most promising approaches for studying the evolutionary conservation and adaptation of crcB across bacterial species?

To study evolutionary conservation and adaptation of crcB across bacterial species, researchers should implement comprehensive comparative genomic and functional approaches:

  • Phylogenomic Analysis:

    • Construct robust phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculate selection pressures (dN/dS ratios) across crcB sequences

    • Identify sites under positive or purifying selection

    • Map conservation patterns onto structural models

  • Structural Comparison:

    • Develop homology models across diverse species

    • Identify conserved structural features versus variable regions

    • Correlate structural conservation with functional importance

  • Horizontal Gene Transfer Analysis:

    • Analyze crcB gene neighborhoods across species

    • Compare gene and species phylogenies to identify transfer events

    • Examine nucleotide composition biases indicative of recent transfers

  • Experimental Validation:

    • Perform cross-species complementation studies

    • Compare biochemical properties of crcB orthologs

    • Test environmental condition responses across diverse species

The C. tepidum study demonstrated the value of comparative approaches by analyzing conservation of specific genes across the Chlorobi phylum, revealing that gene cassettes like CT1276-CT1277 are conserved across multiple species but with interesting evolutionary patterns . Similar approaches could reveal how crcB has evolved and adapted across different bacterial lineages to suit specific ecological niches or physiological requirements.

How can systems biology approaches be applied to understand crcB function in the context of cellular networks?

Systems biology approaches offer powerful frameworks for understanding crcB function within cellular networks:

  • Network Reconstruction:

    • Generate protein-protein interaction networks through affinity purification-mass spectrometry

    • Develop genetic interaction maps using double-mutant analyses

    • Construct metabolic models incorporating crcB-dependent processes

    • Map regulatory networks through ChIP-seq and RNA-seq integration

  • Flux Balance Analysis:

    • Develop constraint-based metabolic models

    • Predict metabolic consequences of crcB perturbation

    • Validate predictions with experimental metabolomics

  • Multi-scale Modeling:

    • Connect molecular simulations of crcB transport to cellular ion homeostasis

    • Model membrane potential changes resulting from crcB activity

    • Integrate cellular responses into population-level phenotypes

  • Perturbation Response Profiling:

    • Apply systematic environmental or genetic perturbations

    • Monitor global cellular responses through multi-omics approaches

    • Identify condition-specific functions of crcB

The C. tepidum transcriptome study revealed coordinated responses involving multiple cellular systems (sulfur metabolism, iron acquisition) following environmental perturbation . Similarly, researchers should examine how crcB function integrates with broader cellular processes like energy metabolism, ion homeostasis, and stress responses. This systems-level perspective will position crcB within its functional context rather than studying it in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.