Recombinant Chlorobium limicola ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorobium limicola ATP synthase subunit b (atpF)

Recombinant Chlorobium limicola ATP synthase subunit b (atpF) is a protein fragment derived from the ATP synthase enzyme complex of the green sulfur bacterium Chlorobium limicola . ATP synthase, also known as F1Fo-ATPase, is a ubiquitous enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells . Specifically, the subunit b (atpF) is a component of the Fo portion of the ATP synthase, which is embedded in the cell membrane and responsible for proton translocation . Recombinant production involves expressing the gene encoding this subunit in a host organism, such as Escherichia coli, and purifying the resulting protein for research or biotechnological applications .

Production and Purification

Recombinant Chlorobium limicola ATP synthase subunit b (atpF) is produced in E. coli with an N-terminal His tag for purification . The His tag allows the protein to be easily purified using affinity chromatography, where the tag binds to a metal resin, such as nickel, and the protein is then eluted .

Role in ATP Synthesis

ATP synthase is essential for energy production in cells. It harnesses the proton motive force generated by respiration or photosynthesis to drive the synthesis of ATP from ADP and inorganic phosphate .

Research Applications

Recombinant Chlorobium limicola ATP synthase subunit b (atpF) and related proteins are used in various research applications:

  • Structural Studies: To determine the three-dimensional structure of the ATP synthase complex and understand its mechanism of action.

  • Protein-Protein Interaction Studies: To identify proteins that interact with the ATP synthase complex and regulate its activity.

  • Drug Discovery: To screen for compounds that inhibit or modulate ATP synthase activity, which could have therapeutic potential in treating bacterial infections or cancer .

  • Bioenergetics Research: To investigate the bioenergetic processes in Chlorobium limicola and other photosynthetic bacteria .

Relevant Data

FeatureDescription
OrganismChlorobium limicola
ProteinATP synthase subunit b (atpF)
Length175 amino acids
Expression HostEscherichia coli
TagN-terminal His tag
Purification MethodAffinity chromatography
FunctionComponent of the Fo complex of ATP synthase, involved in proton translocation and ATP synthesis
UniProt IDB3EIJ6
Sequence SimilarityHigh sequence similarity in c subunits of ATP synthase compared to other bacterial ATP synthases
InhibitorsDCCD (dicyclohexylcarbodiimide) inhibits F-type ATPase by binding to the c subunit
Therapeutic ConnectionsDietary phytochemicals like resveratrol and hydroxytyrosol can inhibit ATP synthase, suggesting potential therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
atpF; Clim_2489; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Target Names
atpF
Target Protein Sequence
MLTSGIILLSGGLLSPNPGLIFWTAVTFVIVLLILKQLAWGPIISALEEREKGIQSSIDR AYSAKDEAEAILRKNRDMLAKADLESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAK DEIEQEKRRALDVLRNEVADLAIMGAEKIIKSSLDADTQKKIVDSMIRDLASKRN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Chlorobium limicola?

ATP synthase subunit b (atpF) in Chlorobium limicola is a critical component of the F-type ATP synthase complex, participating in energy conversion processes essential for this green sulfur bacterium's survival. The atpF gene encodes a 175-amino acid protein that forms part of the peripheral stalk connecting the membrane-embedded F0 portion to the catalytic F1 portion of the ATP synthase complex . This connection is crucial for the mechanical coupling that enables proton translocation to drive ATP synthesis.

The functional importance of atpF is demonstrated by complementation studies where Chlorobium limicola ATP synthase subunits have successfully complemented Escherichia coli mutants defective in corresponding subunits, indicating that hybrid enzymes formed from subunits of these two bacteria remain active in ATP synthesis .

How does the atpF gene organization in Chlorobium limicola differ from other bacteria?

The organization of ATP synthase genes in Chlorobium limicola exhibits distinctive features compared to other bacterial groups. In contrast to purple bacteria, the atp2 operon of Chlorobium limicola (encoding beta and epsilon subunits of F-ATPase) is arranged in a separate operon similar to cyanobacteria . This operon terminates with a pronounced stem-loop structure. Interestingly, although the operon structure resembles that of cyanobacteria, evolutionary tree analysis based on sequence data places the Chlorobium genes closer to purple bacteria .

About 0.8 kb upstream of the beta subunit gene, a gene encoding phosphoenol pyruvate carboxykinase has been identified, which is transcribed in the opposite direction of the atp2 operon and also terminates with a stem-loop structure . This genomic arrangement provides insights into the evolutionary relationships and functional adaptations of ATP synthase components in green sulfur bacteria.

What is the relationship between atpF and the H+/ATP ratio in bioenergetics?

The H+/ATP ratio represents one of the most crucial parameters in bioenergetics, determining the efficiency of energy conversion during ATP synthesis. ATP synthase subunit b (atpF) plays a significant role in maintaining the structural integrity of the F0F1 complex, which directly influences this ratio. The H+/ATP ratio varies among species due to differences in the number of H+-binding c-subunits, resulting in ratios ranging from 2.7 to 5 in naturally occurring systems .

The peripheral stalk, which includes atpF, connects the membrane-embedded proton-conducting components to the catalytic domain. This connection is essential for mechanical coupling between proton translocation and ATP synthesis. Recent engineering efforts have demonstrated that modifications to the peripheral stalk structure can enhance the H+/ATP ratio beyond naturally occurring limits, enabling ATP synthesis even at low proton motive force (pmf) conditions .

What expression systems are optimal for recombinant production of Chlorobium limicola atpF?

For optimal expression of recombinant Chlorobium limicola ATP synthase subunit b (atpF), E. coli-based expression systems have proven effective, as evidenced by successful expression of His-tagged full-length protein (1-175 amino acids) . When designing expression strategies, researchers should consider the following methodological approaches:

Expression System Design:

  • Use E. coli strains optimized for membrane or difficult proteins (BL21-CodonPlus, C41/C43(DE3))

  • Select vectors with tightly controlled promoters (pET series with T7lac promoters)

  • Include solubility-enhancing fusion tags (His tag has been validated )

Expression Conditions:

  • Temperature: Lower induction temperature (16-25°C) generally improves folding

  • Induction: Utilize reduced IPTG concentrations (0.1-0.5 mM) for slower expression

  • Duration: Extended expression periods (overnight at lower temperatures) can increase yield

  • Media: Enriched media (TB or 2YT) can enhance biomass and protein yields

These parameters should be systematically optimized through small-scale expression trials before scaling up production.

What purification strategies yield the highest purity of recombinant atpF protein?

Achieving high purity (>90%) of recombinant Chlorobium limicola atpF requires a multi-step purification strategy, building upon the established protocol using His-tagged protein . The following methodological workflow maximizes purity while preserving functional integrity:

Table 1: Optimized Purification Strategy for Recombinant atpF

Purification StepMethodologyBuffer ConditionsCritical Parameters
Cell LysisSonication or high-pressure homogenizationTris/PBS-based, pH 8.0 with protease inhibitorsMaintain 4°C throughout lysis
Initial CaptureIMAC using Ni-NTA resinTris/PBS with 20-40 mM imidazoleUse gradient elution (50-500 mM imidazole)
Intermediate PurificationIon-exchange chromatographyLow salt buffer (25-50 mM NaCl)Select resin based on theoretical pI of atpF
PolishingSize-exclusion chromatographyTris/PBS-based, pH 8.0, 6% TrehaloseAchieves >90% purity
StorageLyophilization or glycerol stockAdd 5-50% glycerol for liquid storageAvoid repeated freeze-thaw cycles

This progressive purification strategy effectively removes contaminants while maintaining protein stability and activity.

How can solubility and stability of recombinant atpF be optimized during expression and storage?

Optimizing solubility and stability of recombinant Chlorobium limicola atpF requires attention to buffer composition and storage conditions, as membrane-associated proteins often present solubility challenges. Based on established protocols, the following methodological approaches enhance stability:

Solubility Enhancement During Expression:

  • Co-expression with molecular chaperones (GroEL/GroES system)

  • Use of specialized E. coli strains designed for membrane proteins

  • Addition of mild detergents during cell lysis (0.1% Triton X-100 or n-Dodecyl β-D-maltoside)

Buffer Optimization:

  • Tris/PBS-based buffer at pH 8.0 has been validated for stability

  • Addition of 6% trehalose enhances stability during lyophilization and storage

  • Glycerol (5-50% final concentration) is recommended for long-term storage

Storage Protocol:

  • Aliquot protein in small volumes to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C/-80°C

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration

These methodological considerations significantly improve the stability and functional recovery of recombinant atpF protein.

How can researchers evaluate the functional integrity of purified recombinant atpF?

Assessing functional integrity of recombinant Chlorobium limicola atpF requires multiple analytical approaches that examine both structural and functional properties. The following methodological workflow provides comprehensive characterization:

Structural Integrity Assessment:

  • SDS-PAGE analysis to confirm protein purity (>90%) and expected molecular weight

  • Circular dichroism spectroscopy to verify secondary structure composition (predominantly α-helical)

  • Thermal shift assays to evaluate protein stability under various buffer conditions

  • Size exclusion chromatography to assess oligomeric state and homogeneity

Functional Characterization:

  • Binding assays with partner ATP synthase subunits using techniques such as:

    • Surface plasmon resonance

    • Microscale thermophoresis

    • Isothermal titration calorimetry

  • Reconstitution experiments incorporating purified atpF into proteoliposomes with other ATP synthase components

  • Complementation assays in E. coli atpF mutants (building on established complementation of other ATP synthase subunits )

This multi-faceted approach provides comprehensive validation of both structural and functional properties.

What experimental approaches enable study of atpF's role in the ATP synthase mechanism?

Investigating the mechanistic role of atpF in ATP synthesis requires specialized experimental approaches that examine its structural and functional contributions to the ATP synthase complex. The following methodological strategies provide valuable insights:

Structural Analysis Techniques:

  • Cryo-electron microscopy of reconstituted ATP synthase complexes containing atpF

  • Crosslinking mass spectrometry to map interaction interfaces between atpF and other subunits

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Functional Analysis Approaches:

  • Reconstitution of atpF with other ATP synthase components in proteoliposomes for activity assays

  • Measurement of ATP synthesis under controlled proton gradient conditions

  • Determination of H+/ATP ratio and minimum proton motive force (pmf) required for ATP synthesis

  • Site-directed mutagenesis of conserved residues to identify critical functional domains

Interaction Studies:

  • FRET (Förster Resonance Energy Transfer) using fluorescently labeled subunits

  • Pull-down assays using His-tagged atpF to identify interaction partners

  • Bacterial two-hybrid systems for in vivo validation of specific interactions

These complementary approaches collectively illuminate atpF's role in energy coupling and ATP synthesis mechanisms.

How can recombinant atpF advance studies of bacterial bioenergetics?

Recombinant Chlorobium limicola ATP synthase subunit b (atpF) provides a valuable research tool for investigating fundamental aspects of bacterial bioenergetics. Its applications extend across multiple research dimensions:

Studying ATP Synthesis Mechanics:

  • Reconstitution experiments in proteoliposomes to measure ATP synthesis rates under defined conditions

  • Determination of thermodynamic parameters such as the H+/ATP ratio and equilibrium between proton motive force (pmf) and ATP synthesis/hydrolysis

  • Investigation of minimum pmf required for ATP synthesis, which is a critical bioenergetic parameter

Structure-Function Relationships:

  • Site-directed mutagenesis to identify residues critical for peripheral stalk function

  • Hybrid complex formation with components from different species to study evolutionary conservation

  • Analysis of how structural variations influence mechanical coupling efficiency

Probing Energy Conservation Mechanisms:

  • Comparative studies between photosynthetic and non-photosynthetic bacteria

  • Investigation of adaptations in energy conversion systems to different environmental conditions

  • Analysis of how ATP synthase architecture relates to metabolic strategy in green sulfur bacteria

These research applications provide insights into the fundamental principles of biological energy conversion.

What role can recombinant atpF play in comparative studies of phototrophy?

Recombinant Chlorobium limicola atpF serves as an excellent model system for comparative studies of phototrophy across different bacterial lineages. Green sulfur bacteria like Chlorobium limicola employ anoxygenic photosynthesis with unique bioenergetic characteristics that can be investigated using this protein:

Evolutionary Studies:

  • Comparison of ATP synthase components between oxygenic and anoxygenic phototrophs

  • Investigation of how ATP synthase architecture adapts to different photosynthetic mechanisms

  • Analysis of horizontal gene transfer events in the evolution of bioenergetic systems

Functional Adaptations:

  • Examination of how ATP synthase components are optimized for different light harvesting strategies

  • Investigation of the relationship between carbon fixation pathways (such as the rTCA cycle in Chlorobi ) and ATP synthesis machinery

  • Comparative analysis of energy coupling efficiency across photosynthetic lineages

Ecological Adaptations:

  • Study of how ATP synthase function relates to the ability to thrive in specific habitats

  • Investigation of adaptations to low-light environments characteristic of green sulfur bacteria

  • Analysis of bioenergetic efficiency in relation to ecological niche

These comparative approaches provide valuable insights into the diversity and evolution of photosynthetic mechanisms.

How does atpF contribute to understanding carbon fixation in green sulfur bacteria?

ATP synthase subunit b (atpF) plays an integral role in the energy metabolism that supports carbon fixation in green sulfur bacteria, particularly through connections to the reductive tricarboxylic acid (rTCA) cycle employed by Chlorobium limicola. Understanding atpF function provides insights into this specialized metabolism:

Energy-Carbon Fixation Coupling:

  • ATP generated by ATP synthase directly powers the ATP-dependent steps of the rTCA cycle

  • ATP-citrate lyase, a key enzyme in the rTCA pathway of Chlorobium limicola, requires ATP for citrate cleavage

  • The heteromeric ATP-citrate lyase enzyme from Chlorobium limicola is composed of two distinct gene products (aclA and aclB) that show similarity to eukaryotic enzymes

Evolutionary Perspectives:

  • The Chlorobi clade is relatively young, with anoxygenic phototrophy and carbon fixation via the rTCA pathway significantly postdating the rise of atmospheric oxygen

  • ATP citrate lyase in Chlorobi appears to be derived from genes of nitrite oxidizing bacteria through horizontal gene transfer

  • ATP synthase components like atpF may have co-evolved with carbon fixation machinery to optimize energy efficiency

Metabolic Regulation:

  • ATP-citrate lyase activity is regulated by ATP availability and energy status

  • ATP levels maintained by ATP synthase directly influence carbon fixation rate

  • ADP and oxaloacetate inhibit ATP-citrate lyase activity, creating feedback loops between energy production and carbon fixation

This integration of energy metabolism and carbon fixation represents a specialized adaptation in green sulfur bacteria.

What are common challenges when working with recombinant atpF and their solutions?

Working with recombinant Chlorobium limicola ATP synthase subunit b (atpF) presents several technical challenges that can be addressed through specific methodological approaches. The following table summarizes common issues and their solutions:

Table 2: Troubleshooting Guide for Recombinant atpF Work

ChallengeCauseSolution Methodology
Low expression yieldToxicity to host, protein instability- Use tightly controlled inducible promoters
- Lower induction temperature (16-20°C)
- Utilize specialized E. coli strains for membrane proteins
Poor solubilityMembrane association, improper folding- Add mild detergents during lysis (0.05-0.1% DDM)
- Include 6% trehalose in buffer
- Consider fusion partners to enhance solubility
Protein instabilityStructural instability when isolated- Add 5-50% glycerol to storage buffer
- Store at -20°C/-80°C and avoid freeze-thaw cycles
- Consider co-expression with stabilizing partner proteins
Inadequate purityNon-specific binding to purification resin- Implement multi-step purification strategy
- Optimize imidazole concentrations in IMAC
- Include size exclusion chromatography as final step
Loss of activityDenaturation during purification- Monitor protein at all purification stages
- Maintain cold temperature throughout processing
- Validate functional integrity by interaction studies

Following these methodological solutions enables researchers to overcome technical barriers and obtain high-quality recombinant atpF for experimental use.

What analytical methods verify the structural integrity of recombinant atpF?

Verifying the structural integrity of recombinant Chlorobium limicola atpF requires a multi-technique analytical approach that examines various structural parameters. The following methodological workflow provides comprehensive structural characterization:

Primary Structural Verification:

  • Mass spectrometry to confirm exact molecular weight and sequence integrity

  • N-terminal sequencing to verify the absence of unwanted proteolysis

  • SDS-PAGE analysis under reducing and non-reducing conditions to assess purity (>90%) and detect potential aberrant disulfide formation

Secondary/Tertiary Structure Analysis:

  • Circular dichroism spectroscopy to quantify secondary structure content (expected high α-helical content)

  • Fluorescence spectroscopy to assess tertiary structure through intrinsic tryptophan fluorescence

  • Thermal shift assays to determine melting temperature and stability in various buffer conditions

Quaternary Structure Evaluation:

  • Size exclusion chromatography to determine oligomeric state

  • Dynamic light scattering to assess homogeneity and detect aggregation

  • Analytical ultracentrifugation to precisely determine molecular mass and shape parameters

Implementing this analytical cascade provides a comprehensive assessment of structural integrity at all levels of protein organization.

What controls are essential in experimental designs using recombinant atpF?

Robust experimental design using recombinant Chlorobium limicola atpF requires appropriate controls to ensure valid and reproducible results. The following control elements should be incorporated into research protocols:

Expression and Purification Controls:

  • Empty vector control - processed identically to atpF-expressing construct

  • Well-characterized control protein expressed under identical conditions

  • Purification of the same protein batch under different conditions to assess stability

Functional Assay Controls:

  • Heat-denatured atpF sample as negative control for activity/binding assays

  • E. coli ATP synthase subunit b as reference for comparative studies

  • Site-directed mutants of conserved residues to validate structure-function relationships

Interaction Study Controls:

  • Unrelated proteins of similar size/charge properties to verify binding specificity

  • Competition assays with unlabeled protein to confirm binding site specificity

  • Stepwise reconstitution experiments to identify minimal functional units

Experimental System Controls:

  • Liposomes without incorporated protein for reconstitution experiments

  • Buffer-only controls for all spectroscopic measurements

  • Time-course stability measurements to ensure protein integrity throughout experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.