Recombinant Chlorobium limicola Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

CbiM operates within the ECF transporter complex (CbiM-Q-O) to facilitate Co²⁺ uptake. Key findings include:

  • Dynamic Interaction with CbiN:

    • CbiN, a membrane protein with two transmembrane helices, transiently interacts with CbiM via loop-loop contacts to enable cobalt insertion into its binding pocket .

    • Deletions in the CbiN loop abolish transport activity, underscoring its role in structural stabilization .

  • Transport Cycle:

    • CbiM alternates between inward- and outward-facing conformations to bind extracellular Co²⁺ and release it intracellularly .

    • ATP hydrolysis by the CbiQ-O subunits energizes this process .

Key Residues

  • Metal-binding ligands: His¹⁰⁰, Asp¹⁰³, His¹⁰⁷, and His¹⁷² (N-terminal loop) .

  • Mutations in these residues reduce Co²⁺ affinity by >90% .

Cobalamin Biosynthesis

CbiM is essential for cobalt incorporation during vitamin B12 synthesis in C. limicola. Recombinant CbiM enables heterologous cobalamin production in engineered strains like Bacillus licheniformis, achieving ergothioneine yields of 12–25 mg/L under optimized conditions .

Biogas Cleanup

C. limicola’s hydrogen sulfide oxidation capability, linked to sulfur-metabolizing genes (e.g., sox cluster), has applications in biogas desulfurization .

Heterologous Production (2025)

  • Recombinant CbiM expressed in B. licheniformis improved ergothioneine synthesis rates by 30% compared to native C. limicola enzymes .

Future Directions

  • Protein Engineering: Optimizing CbiM-CbiN interactions could enhance Co²⁺ transport rates for industrial vitamin B12 production .

  • Environmental Applications: Leveraging C. limicola’s sulfur-oxidizing genes (soxA, soxB) alongside CbiM may improve biogas purification systems .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for specific delivery timelines.
Important Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
cbiM; Clim_1060; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-254
Protein Length
Full Length of Mature Protein
Species
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Target Names
cbiM
Target Protein Sequence
MHIMEGFLPPSWSLFWWVLTLPFLVVGFRSLRKIVDANPRMKLLLAMAGAFAFVLSSLKI PSVTGSCSHPTGVGLGAVLFGPSVMSVLGVIVLLFQALLLAHGGLTTLGANAFSMAIAGP FVSYGIYRLMVMSKAPEWLAVFLAAAIGDLMTYVVTSLQLALAFPSVTGGIAASLGKFMT IFALTQVPLAISEGILTVMVFSAIREYASELFPASGTLAKEGV
Uniprot No.

Target Background

Function
This protein is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which is involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium limicola and why is it significant in microbiological research?

Chlorobium limicola is a gram-negative bacterial member of green sulfur bacteria found in freshwater hot springs. This organism is a non-motile mesophile that functions as a photoautotrophic/photosynthetic strict anaerobe, playing crucial roles in carbon, nitrogen, and sulfur cycles within anoxic freshwater environments . Its significance stems from its unique metabolic capabilities, particularly its use of the reverse TCA cycle for carbon fixation, making it an excellent model organism for studying alternative carbon fixation pathways . The strain DSMZ 245 T, isolated from Gilroy Hot Springs in California, has been fully sequenced with a genome of 2,763,181 bp containing 2,576 total genes (2,522 protein-coding) .

What is the CbiMNQO transport system and how does CbiM function within it?

The CbiMNQO transporter belongs to the energy-coupling factor (ECF) transporter family, a large group of ATP-binding cassette transporters found in microorganisms that are responsible for micronutrient uptake from the environment . Within this group-I ECF transporter:

  • CbiM functions as the membrane substrate-binding component (EcfS)

  • CbiN is a small membrane component specific to cobalt transport

  • CbiQ serves as the integral membrane scaffold component (EcfT)

  • CbiO acts as the cytoplasmic ATP binding/hydrolysis component (EcfA)

Research has demonstrated that the substrate-binding subunit CbiM stimulates the basal ATPase activity of CbiQO, indicating an important regulatory role in the transport process .

How does the structure of CbiM relate to its function in cobalt transport?

Structural analysis of the CbiMQO complex revealed that CbiM contains a substrate-gating L1 loop that plays a critical role in the transport mechanism . The transporter has been observed in an inward-open conformation, which provides insights into the substrate translocation pathway. According to the working model proposed for CbiMNQO:

  • ATP binding to CbiO induces conformational changes

  • These changes propagate to CbiQ and then to CbiM

  • The process involves rotation or toppling of both CbiQ and CbiM

  • CbiN likely functions in coupling conformational changes between CbiQ and CbiM

This mechanism allows for the energy-dependent transport of cobalt ions across the membrane, which is essential for the synthesis of vitamin B12 and other cobalt-dependent processes in the bacterium.

What expression systems are most effective for recombinant CbiM production?

Based on research with similar membrane proteins, Escherichia coli expression systems have proven effective for the heterologous expression of CbiM and other components of the transport system . When working with CbiM:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, well-established protocolsMay require optimization of induction conditions
E. coli C41/C43Specifically designed for membrane proteinsLower yields but better folding for complex proteins
Cell-free systemsAvoids toxicity issues, direct access to reactionHigher cost, potentially lower yield

For optimal results, co-expression of CbiM with its partner proteins (particularly CbiQ and CbiO) is recommended, as demonstrated in studies of the CbiMQO complex structure determination .

What purification strategies yield the highest purity and activity for recombinant CbiM?

Purification of membrane proteins like CbiM requires specialized approaches:

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization using mild detergents (DDM, LMNG, or digitonin)

  • Affinity chromatography (typically using histidine tags)

  • Size exclusion chromatography for final polishing

For functional studies, it's critical to maintain the protein in a lipid-like environment, either through detergent micelles, nanodiscs, or liposome reconstitution. Similar approaches have been successfully applied to other membrane proteins from C. limicola, such as the ATP-citrate lyase components .

What methods have been used to determine the structure of CbiM and similar ECF transporters?

The structure of the CbiMQO complex has been determined in its inward-open conformation, providing valuable insights into the transport mechanism . Key methodologies include:

TechniqueResolutionInformation Provided
X-ray crystallographyTypically 2.0-3.5 ÅHigh-resolution static structures
Cryo-electron microscopy3.0-4.5 ÅStructures without crystallization, multiple conformations
Hydrogen-deuterium exchange MSPeptide-levelConformational dynamics, protein-protein interfaces
Cross-linking mass spectrometryResidue-levelSpatial constraints, interaction sites

The CbiO component has been characterized in its β,γ-methyleneadenosine 5′-triphosphate-bound closed conformation, revealing the ATP-binding and hydrolysis mechanism that drives transport .

How can researchers assess the functional activity of recombinant CbiM?

Functional assessment of CbiM requires evaluating both its ability to bind cobalt and its participation in the complete transport cycle:

  • Metal binding assays:

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Fluorescence spectroscopy with metal-sensitive probes

    • Equilibrium dialysis with radioactive cobalt isotopes

  • Transport assays:

    • Liposome reconstitution with purified CbiMNQO components

    • Whole-cell uptake assays using radioactive cobalt

    • ATPase activity coupling measurements (similar to those performed for the CbiMQO complex)

For accurate assessment, it's essential to verify that CbiM stimulates the ATPase activity of CbiQO, as this functional interaction is characteristic of properly folded and assembled components .

How does the CbiMNQO system compare to other bacterial metal transport systems?

The CbiMNQO system represents a distinct class of metal transporters within the ECF transporter family. Comparative analysis reveals:

Transporter SystemMetal SubstrateEnergy SourceStructural Organization
CbiMNQO (C. limicola)CobaltATPFour-component ECF (Group I)
NiCoT familyNickel/CobaltProton gradientSingle-component secondary transporters
CorA familyMagnesium/CobaltConcentration gradientHomopentameric channels
ABC metal transportersVariousATPTwo transmembrane + two ATPase components

Unlike many other metal transporters, the CbiMNQO system utilizes a unique toppling mechanism where both CbiQ and CbiM undergo rotation during the transport cycle, with CbiN coupling the conformational changes between these components .

What is known about the regulation of cbiM gene expression in C. limicola?

While specific regulatory mechanisms for cbiM in C. limicola are not fully characterized in the search results, general principles of metal transporter regulation suggest several potential mechanisms:

  • Metal-dependent transcriptional regulators (likely responding to cobalt availability)

  • Cobalamin riboswitch mechanisms (sensing vitamin B12 levels)

  • Coordination with genes involved in cobalamin biosynthesis

The genomic context of C. limicola, with its 2,763,181 bp genome containing 2,576 total genes , provides a framework for investigating regulatory networks controlling cbiM expression through comparative genomic and transcriptomic approaches.

How might the CbiM transport system be integrated with C. limicola's unique carbon fixation pathway?

C. limicola utilizes the reductive tricarboxylic acid (RTCA) cycle for carbon dioxide fixation , a pathway that requires several metalloenzymes. The ATP-citrate lyase, a key enzyme in this pathway, has been characterized as a heteromeric enzyme composed of two distinct gene products (aclA and aclB) .

The integration between cobalt transport and carbon fixation likely occurs through:

  • Cobalt-dependent enzymes in the RTCA cycle or connected pathways

  • Shared regulatory mechanisms responding to energy status

  • Metabolic feedback loops connecting metal availability to carbon fixation rates

The ATP-citrate lyase from C. limicola requires ATP and is regulated by energy conditions , suggesting potential coordination with ATP-consuming transport processes like those mediated by CbiMNQO.

What are critical considerations for experimental design when studying CbiM?

Research involving membrane proteins like CbiM requires careful experimental design:

  • Appropriate controls:

    • Empty vector controls for expression systems

    • Inactive mutants (e.g., ATPase-deficient CbiO)

    • Detergent-only controls for solubilization effects

  • Replication strategies:

    • Use biological replicates (independent cultures/preparations) rather than just technical replicates to account for biological variability

    • Minimum of three biological replicates for statistical validity

  • Avoiding confounding factors:

    • Control for metal contamination in buffers and reagents

    • Account for endogenous transport systems in host organisms

    • Consider detergent effects on protein activity

  • Validation approaches:

    • Multiple complementary techniques to confirm findings

    • Both in vitro and in vivo validation when possible

How can researchers address common challenges in membrane protein research for CbiM studies?

Working with membrane proteins like CbiM presents specific challenges:

ChallengeSolution StrategyRationale
Protein aggregationScreen multiple detergents or use amphipols/nanodiscsDifferent membrane proteins require different solubilization conditions
Low expression yieldsOptimize codon usage, use specialized strains, lower induction temperatureReduces toxicity and improves folding efficiency
Loss of native lipid interactionsLiposome reconstitution with E. coli or synthetic lipidsRestores lipid environment necessary for function
Difficulty in assessing transportDevelop indirect assays (e.g., ATPase coupling)Provides functional readout without direct transport measurement

For complex systems like CbiMNQO, co-expression of partner proteins can significantly improve stability and functional activity, as demonstrated in the structural studies of the CbiMQO complex .

What are promising research avenues for expanding our understanding of CbiM function?

Several exciting directions remain for further investigation of CbiM:

  • Structural dynamics:

    • Time-resolved studies of conformational changes during the transport cycle

    • Single-molecule FRET to track CbiM movements relative to CbiQ and CbiN

  • Substrate specificity:

    • Mutagenesis of the L1 loop to alter metal selectivity

    • Comparative studies with CbiM homologs from diverse bacteria

  • Integration with cellular metabolism:

    • Systems biology approaches connecting cobalt transport to cobalamin synthesis and carbon fixation

    • Metabolic flux analysis under varying cobalt availability conditions

  • Applications in biotechnology:

    • Potential use in biogas cleanup systems, leveraging C. limicola's sulfur metabolism capabilities

    • Engineering CbiM for enhanced metal recovery or bioremediation applications

These research directions build upon the established understanding of CbiM structure and function while addressing gaps in our knowledge of this important transport protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.