Recombinant Chlorobium limicola Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Clim_1202; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Target Names
mscL
Target Protein Sequence
MLKEFREFVLRGNVADMAVGIIIGGAFGAIVNTLVSDVLMPPLGLLIGGIDFSNFYLVLK EGSAPGPYAALADAKAVGAVTVNYGIFLNALISFMIMAFAVFMLIKSLTSMRGKPEPPAP APAVKECPYCCSTIPLKASRCPECTSQLEK
Uniprot No.

Target Background

Function
A mechanosensitive channel activated by membrane stretch forces. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Chlorobium limicola MscL expressed and purified for functional studies?

Recombinant MscL is expressed in E. coli BL21(DE3) using a pET vector system with an N-terminal His tag (search result ). Optimization involves:

  • Induction conditions: 0.5 mM IPTG at OD600 = 0.6–0.8, 16–20 hr at 18°C to minimize inclusion body formation.

  • Purification: Immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography (SEC) in Tris/PBS-based buffer (pH 8.0) with 6% trehalose to stabilize the protein .

  • Quality control: SDS-PAGE confirms >90% purity, while circular dichroism (CD) spectroscopy validates α-helical content (~60%), consistent with transmembrane domains .

Data Table 1: Key Protein Specifications

ParameterValueSource
SpeciesChlorobium limicola
Length150 residues (Full-length)
Purity>90% (SDS-PAGE)
Storage-80°C in 50% glycerol

What functional assays confirm MscL activity post-purification?

Two primary methods are used:

  • Liposome reconstitution: Proteoliposomes are subjected to hypo-osmotic shock while monitoring solute release via fluorescence de-quenching (e.g., calcein) .

  • Patch-clamp electrophysiology: Single-channel recordings at ±40 mV in symmetrical 200 mM KCl, 10 mM HEPES (pH 7.4) reveal a conductance of ~3 nS, characteristic of large-conductance channels .

    • Critical controls: Include empty vector lysates and MscL-knockout E. coli to exclude endogenous channel interference .

How does Chlorobium limicola MscL compare structurally to E. coli MscL?

Sequence alignment shows 38% identity with E. coli MscL (UniProt A1AGI2 vs. B3ECJ4). Key differences:

  • N-terminal domain: Chlorobium MscL has a shorter amphipathic helix (residues 1–15 vs. 1–22 in E. coli), reducing lipid bilayer coupling efficiency .

  • Pore-lining residues: Substitutions at Gly22 (C. limicola) vs. Gly26 (E. coli) alter tension sensitivity .

  • Oligomeric state: Both form pentamers, but cross-linking assays suggest differing stability under oxidative stress .

How to resolve contradictions in reported tension thresholds for MscL gating?

Discrepancies arise from experimental models (liposomes vs. native membranes) and measurement techniques:

  • Lipid bilayer composition: Phosphatidylethanolamine (PE)-rich membranes lower gating tension by 30% compared to phosphatidylcholine (PC) membranes .

  • Methodological bias: Patch-clamp overestimates tension due to membrane-cytoskeleton interactions, whereas fluorescence assays underestimate it .

  • Solution: Use molecular dynamics (MD) simulations with MARTINI force fields to correlate lateral pressure profiles with experimental data .

What strategies address heterogeneity in MscL oligomerization during purification?

Heterogeneity stems from C-terminal flexibility and detergent choice:

  • Detergent screening: Lauryl maltose neopentyl glycol (LMNG) preserves pentameric state better than DDM .

  • Cross-linking: 1% glutaraldehyde pre-treatment stabilizes oligomers prior to SEC .

  • Validation: Native PAGE and negative-stain EM confirm monodisperse pentamers .

How to engineer the N-terminal domain to study its role in mechanotransduction?

Stepwise approach:

  • Truncation mutants: Delete residues 1–7 (Δ2–7) to disrupt TM2 interactions, increasing mobility (EPR spectroscopy) .

  • Site-directed mutagenesis: Replace K5 and E9 with alanine to test electrostatic interactions with TM2 .

  • Functional assays: Compare patch-clamp thresholds (lysoPC titration) and liposome rupture kinetics between mutants .

Data Table 2: Mutant Phenotypes

MutantTension Threshold (mN/m)Open State Lifetime (ms)Source
Wild-type12 ± 1.515 ± 3
Δ2–718 ± 2.15 ± 1
K5A/E9A16 ± 1.88 ± 2

Can Chlorobium MscL be integrated into synthetic biology systems for osmotic sensing?

Yes, but with modifications:

  • Chimeric channels: Fuse Chlorobium MscL’s pore domain (residues 30–150) with E. coli’s N-terminus to enhance tension sensitivity .

  • Biosensor applications: Couple MscL to fluorescent reporters (e.g., pHluorin) for real-time osmotic shock detection in extremophile engineering .

  • Validation: Microfluidics-driven osmotic gradients confirm response linearity (R² > 0.95) between 0–500 mOsm .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.