Recombinant Chlorobium limicola Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Clim_1798; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Target Names
lspA
Target Protein Sequence
MKWFFTFASVVVLLDQFTKKLAVLFLRDRGTVTIIPDWLKLTYAENNGIAFGVEFASQAI MILLVGSISLMIALYVLKSGNRKTLFLLPFSLIFGGGIGNLIDRLTVGRVIDFIHFDLYQ GTIMGSWVSLWPIFNVADSAITIGACMLILLHNRIFPEPDTKAENHVR
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of LspA in Chlorobium limicola physiology?

LspA (Lipoprotein signal peptidase II) in Chlorobium limicola likely plays a critical role in the processing of bacterial lipoproteins that contribute to cell envelope integrity. As a strict anaerobic photosynthetic bacterium found in freshwater hot springs, C. limicola depends on properly processed membrane proteins for maintaining its unique ecological niche . The enzyme functions in the multistep lipoprotein processing pathway where it cleaves prolipoproteins after they've been modified by Lgt (preprolipoprotein diacylglycerol transferase) . This cleavage occurs at the N-terminal side of the +1 position cysteine residue of the prolipoprotein . Given C. limicola's importance in carbon, nitrogen, and sulfur cycles in anoxic environments, properly functioning LspA would be essential for the organism's environmental adaptations and metabolic processes .

How can recombinant Chlorobium limicola LspA be expressed and purified for research?

Based on protocols for other bacterial LspA enzymes, recombinant C. limicola LspA can be expressed using an E. coli-based expression system with the following methodology:

  • Gene synthesis and vector construction:

    • Obtain the lspA gene sequence from C. limicola genome (which has been fully sequenced with 2,576 total genes)

    • Optimize codons for E. coli expression using optimization tools

    • Clone into an expression vector (e.g., pET28a) with a hexahistidine tag and TEV protease cleavage site

  • Protein expression:

    • Transform the recombinant plasmid into E. coli strain C43(DE3) or similar expression hosts

    • Grow transformed cells in TB media with appropriate antibiotic (kanamycin 50 μg/mL)

    • Induce expression with 1 mM IPTG when OD600 reaches 0.5-0.6

    • Continue expression at 30°C with shaking at 180 rpm for approximately 18 hours

  • Purification protocol:

    • Harvest cells by centrifugation (6000 × g, 15 min, 4°C)

    • Cell lysis and membrane protein extraction using detergents

    • Purify using nickel affinity chromatography targeting the His-tag

    • Consider TEV protease cleavage to remove the tag if needed

    • Further purification via size exclusion chromatography

The yield and stability of the purified protein should be monitored throughout the process, with detergent selection being crucial for maintaining enzymatic activity.

What assays can be used to determine recombinant C. limicola LspA activity?

Two complementary approaches can be employed to assess enzymatic activity:

  • Gel-shift activity assay:

    • Prepare reaction mixture containing 12 μM pre-prolipoprotein substrate, 250 μM DOPG lipids, and 1.2 μM Lgt in buffer (50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG)

    • Incubate at 37°C for 60 minutes to allow Lgt-catalyzed conversion to LspA substrate

    • Add 0.5 μM recombinant LspA to initiate the reaction

    • Remove samples at timed intervals and stop with SDS loading buffer

    • Analyze using SDS-PAGE to detect mobility shift between prolipoprotein and processed lipoprotein

  • FRET-based assay:

    • Utilize a fluorescence resonance energy transfer (FRET) lipopeptide substrate

    • Monitor reaction kinetics through increased fluorescence upon peptide cleavage

    • This allows determination of kinetic parameters including Km and Vmax

    • The recombinant LspA from other bacteria has shown apparent Km values between 10-47 μM with varying Vmax values

These assays can be used to assess both wild-type and mutant LspA activities, as well as to determine inhibitory effects of compounds like globomycin.

How does C. limicola LspA differ from other bacterial LspA enzymes?

While specific data on C. limicola LspA is limited in the search results, comparative analysis can be inferred:

  • Evolutionary context:

    • C. limicola belongs to green sulfur bacteria, a distinct phylogenetic group from the proteobacteria and firmicutes where LspA has been more extensively studied

    • Its photoautotrophic, strict anaerobic lifestyle likely influences structural adaptations in its membrane proteins

  • Potential structural differences:

    • LspA enzymes from different species show varying substrate affinities and catalytic efficiencies

    • For example, P. aeruginosa LspA shows higher substrate affinity (Km ~10 μM) and catalytic efficiency (Vmax ~107 nmol/(mg min)) compared to S. aureus LspA (Km ~47 μM, Vmax ~2.5 nmol/(mg min))

    • C. limicola LspA may have unique adaptations based on its environmental niche

  • Inhibition profile:

    • Sensitivity to inhibitors like globomycin varies across species, with S. aureus LspA showing different inhibition patterns from P. aeruginosa LspA

    • C. limicola LspA inhibition profile would need empirical determination

  • Genomic context:

    • C. limicola's genome size of 2,763,181 bp with 2,522 protein-coding genes provides the genetic context for LspA function

    • Understanding these genomic surroundings may reveal co-evolved systems specific to C. limicola

What approaches can be used to determine the crystal structure of C. limicola LspA?

Determining the crystal structure of C. limicola LspA would require the following comprehensive approach:

  • Protein preparation optimization:

    • Express recombinant protein with various fusion tags (His, MBP, SUMO) to improve solubility and stability

    • Screen multiple detergents for optimal membrane protein extraction and stability

    • Perform thermal stability assays to identify buffer conditions that maximize protein stability

    • Consider lipid nanodiscs or amphipols as alternatives to detergents for maintaining native-like environment

  • Crystallization strategy:

    • Employ sparse matrix screening with commercial kits designed for membrane proteins

    • Utilize lipidic cubic phase (LCP) crystallization methods which have proven successful for membrane proteins

    • Test co-crystallization with known inhibitors (globomycin, myxovirescin) as demonstrated successful with S. aureus LspA

    • Consider antibody-mediated crystallization to provide additional lattice contacts

  • Data collection and structure determination:

    • Collect high-resolution X-ray diffraction data at synchrotron sources

    • Consider molecular replacement using existing LspA structures as search models

    • If molecular replacement fails, prepare selenomethionine-labeled protein for experimental phasing

    • Validate structure using multiple refinement approaches and stereochemical assessment

  • Structure analysis:

    • Compare with existing LspA structures to identify conserved catalytic residues

    • Map sequence conservation across species onto the structure

    • Identify potential substrate binding sites and catalytic residues specific to C. limicola LspA

How can inhibitor studies with C. limicola LspA inform novel antimicrobial development?

Inhibitor studies with recombinant C. limicola LspA can provide valuable insights for antimicrobial development through these approaches:

  • Comparative inhibition analysis:

    • Test natural inhibitors like globomycin and myxovirescin against C. limicola LspA

    • Determine IC50 values and compare with other bacterial LspA enzymes

    • Analyze structure-activity relationships to identify key pharmacophore features

  • Inhibitor binding mechanisms:

    • Crystal structures of inhibitor-enzyme complexes reveal that despite different molecular structures, globomycin and myxovirescin inhibit LspA identically

    • They function as non-cleavable tetrahedral intermediate analogs

    • The inhibitors share a 19-atom motif that recapitulates part of the substrate lipoprotein binding mode

  • Rational design strategy:

    • Utilize the 19-atom inhibitor motif identified in existing crystal structures

    • Incorporate this motif into novel scaffolds with improved pharmacokinetic properties

    • Develop compounds with built-in resistance hardiness by targeting conserved binding elements

  • Novel inhibitor screening:

    • Develop high-throughput FRET-based assays for rapid compound screening

    • Test inhibitor efficacy across diverse bacterial LspA enzymes to identify broad-spectrum candidates

    • Evaluate synergistic effects with other antimicrobial agents

This research has significant implications for addressing antimicrobial resistance, as LspA represents a novel target with limited existing resistance mechanisms.

What structure-function investigations can reveal the catalytic mechanism of C. limicola LspA?

In-depth structure-function studies can elucidate the catalytic mechanism through:

  • Site-directed mutagenesis of key residues:

    • Target conserved catalytic residues identified through sequence alignment and structural analysis

    • Focus on residues in the enzyme active site and substrate binding pocket

    • Create a comprehensive mutation panel including:

      • Catalytic residues (for S. aureus LspA, these include conserved aspartates)

      • Loop flexibility determinants (e.g., Gly54, which when mutated to Pro inactivates the enzyme)

      • Substrate recognition residues

  • Enzyme kinetics with mutant variants:

    • Analyze changes in Km and kcat to determine effects on substrate binding vs. catalysis

    • Generate a kinetic model of the enzyme mechanism

    • Employ pre-steady-state kinetics to identify rate-limiting steps

  • Extracellular loop (EL) flexibility analysis:

    • Investigate the role of the flexible extracellular loop (EL) which demonstrates important conformational changes during inhibitor binding

    • The EL flexibility appears critical for both substrate processing and inhibitor binding

    • For example, in S. aureus LspA, the loop includes Trp57 which adopts different conformations to secure inhibitors in place

  • Spectroscopic studies:

    • Utilize FTIR, CD spectroscopy to monitor conformational changes

    • Apply HDX-MS (hydrogen-deuterium exchange mass spectrometry) to map dynamic regions and substrate interactions

    • Employ NMR for solution-state dynamics analysis of key protein regions

What role does C. limicola LspA play in bacterial survival under environmental stress?

Understanding C. limicola LspA's role in stress response requires multifaceted approaches:

  • Gene knockout and complementation studies:

    • Generate lspA deletion mutants in C. limicola

    • Perform complementation with wild-type and mutant lspA variants

    • Assess survival under various stressors including:

      • Temperature fluctuations (relevant to hot spring environments)

      • Oxygen exposure (critical for strict anaerobes)

      • Nutrient limitation

      • pH fluctuations

  • Lipoprotein profiling under stress conditions:

    • Compare lipoprotein processing patterns between wild-type and lspA mutants

    • Identify specific lipoproteins whose processing is affected during stress

    • Determine whether the lspA mutation affects C. limicola's ability to perform key metabolic functions like carbon fixation via the reverse TCA cycle

  • Comparative virulence studies:

    • While C. limicola is not a pathogen, comparative analysis with pathogenic systems is informative

    • In S. aureus, LspA activity is important for survival in human blood but not in plasma

    • This suggests LspA plays a role in defense against phagocytes rather than affecting general growth

    • Similar functional studies in C. limicola could reveal the enzyme's role in environmental adaptation

  • Systems biology approach:

    • Perform transcriptomic and proteomic analyses comparing wild-type and lspA mutants

    • Map changes to specific metabolic and stress response pathways

    • Integrate with C. limicola's role in biogeochemical cycles

How can C. limicola LspA be leveraged for biotechnological applications?

C. limicola LspA has potential biotechnological applications that can be explored through:

  • Protein engineering for improved biocatalysis:

    • Engineer C. limicola LspA for enhanced stability and activity under industrial conditions

    • Develop variants with altered substrate specificity for custom lipoprotein processing

    • Create chimeric enzymes incorporating beneficial features from various bacterial LspA proteins

  • Integration with C. limicola's existing biotechnological potential:

    • C. limicola already shows promise for biogas cleanup through hydrogen sulfide oxidation

    • It converts hydrogen sulfide to elemental sulfur, potentially eliminating chloroform use in sulfur extraction

    • Engineered LspA could enhance membrane integrity under industrial conditions, improving process efficiency

  • Development of biosensors:

    • Utilize the specificity of LspA-substrate interactions to develop biosensors for:

      • Environmental contaminant detection

      • Monitoring bacterial populations in environmental samples

      • Screening compound libraries for antimicrobial activity

  • Experimental parameters for optimized enzyme activity:

ParameterOptimum RangeNotes
pH7.0-7.5Based on activity assays with other LspA enzymes
Temperature30-37°CMay vary based on C. limicola's hot spring habitat
Detergent0.02% LMNGCritical for maintaining membrane protein activity
Salt (NaCl)150 mMBased on buffer composition in LspA assays
Reducing agent1 mM DTTHelps maintain cysteine residues in reduced state
  • Comparative kinetic parameters:

LspA SourceKm (μM)Vmax (nmol/mg·min)Enzyme ConcentrationReference
P. aeruginosa101070.1 μMSearch result
S. aureus472.50.3 μMSearch result
C. limicolaTo be determinedTo be determinedN/AExperimental target

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.