Recombinant Chlorobium limicola Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biological Function

  • Role in C. limicola: HtpX is a zinc-dependent protease implicated in quality control of membrane proteins under stress conditions, potentially aiding in thermal or oxidative stress adaptation .

  • Mechanism: Homologs of HtpX in other bacteria (e.g., E. coli) degrade misfolded proteins via ATP-independent proteolysis, suggesting a conserved role in cellular homeostasis .

Biotechnological Applications

  • ELISA & Protein Studies: Used as a reagent in immunoassays due to its high purity and specificity .

  • Stress Response Research: Serves as a model enzyme for studying bacterial adaptation to environmental stressors .

  • Bioremediation Potential: C. limicola’s sulfur metabolism suggests HtpX could indirectly support biogas cleanup by stabilizing sulfur-cycle enzymes.

Research Challenges

  • Expression Optimization: Heterologous production in E. coli risks proteolytic degradation, necessitating strain engineering or protease inhibitors .

  • Functional Redundancy: Overlapping roles with other proteases (e.g., Lon) complicate phenotype analysis in knockout studies .

Comparative Analysis with Homologs

OrganismHtpX Homolog FeaturesReference
Geobacter uraniireducens285 aa, His-tagged, expressed in E. coli, 90% purity
Escherichia coliInvolved in heat shock response; substrate specificity differs

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Clim_1447; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Target Names
htpX
Target Protein Sequence
MKRVVLFLLTNLAVMLVLSVSARILGVDRFLTSNGLDMGMLLVFAALIGFGGSFISLLMS KTMAKWSTGARVIERPANQDEAWLVDTVRQLSKKAGLQMPEVAIYDGAPNAFATGPSKSR SLVAVSTGLMQSMNKKEVGAVLAHEVAHIQNGDMVTLTLIQGVVNTFVIFLSRLAAYAVD SFLRRDDDESGSPGIGYWISSIAFEIMFGILASVVVMCFSRKREYRADAGAAALMGDRAP MIDALRALGGLEAGRLPKEMAASGIAGGGMMALFSSHPPLESRIAALESAS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX homolog and what is its biological significance?

Protease HtpX homolog is a putative membrane-bound zinc metalloproteinase that belongs to the M48 family of proteases. It plays a crucial role in the proteolytic quality control of membrane proteins in bacteria. The protein participates in degrading misfolded or damaged membrane proteins, helping maintain membrane integrity and cellular homeostasis. Any structural or functional disturbance in this protein may lead to infections, particularly endodontic infections as observed in some bacterial species . In Chlorobium limicola, htpX is particularly important for maintaining membrane protein quality during photosynthetic growth and sulfur metabolism .

How does htpX function in the context of Chlorobium limicola's metabolism?

Chlorobium limicola is an autotrophic, green phototrophic bacterium that utilizes reduced sulfur compounds to fix carbon dioxide in the light . Within this metabolic context, htpX likely plays a role in quality control of the membrane proteins involved in photosynthesis and sulfur oxidation pathways. The protein may be particularly important during environmental stress conditions, such as temperature fluctuations or oxidative stress, which can damage membrane proteins. Western analysis of related systems shows that similar proteins (such as cytochrome c-551) are regulated by thiosulfate in Chlorobium, suggesting a potential regulatory link between sulfur metabolism and quality control mechanisms, possibly involving htpX .

What are the optimal conditions for expression and purification of Recombinant Chlorobium limicola Protease HtpX homolog?

Based on established protocols for similar recombinant proteins, the following expression and purification methodology is recommended:

Expression System:

  • E. coli is the preferred heterologous expression system, particularly BL21(DE3) strains optimized for membrane protein expression .

  • Expression vector should include an N-terminal His tag for purification purposes .

  • Induction with 0.5-1.0 mM IPTG at reduced temperature (16-20°C) for 16-18 hours typically yields better results for membrane proteins.

Purification Strategy:

  • Cell lysis using mild detergents (e.g., n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane fractions.

  • Initial purification via Ni-NTA affinity chromatography using the His tag.

  • Further purification using size exclusion chromatography.

  • Storage in Tris-based buffer with 50% glycerol at -20°C for extended stability .

Reconstitution Guidance:
The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein activity.

How can protease activity of htpX be reliably measured in laboratory settings?

Several approaches can be employed to measure htpX protease activity:

In vivo Assay System:
A semiquantitative and convenient in vivo protease activity assay system has been established for E. coli HtpX, which can be adapted for the Chlorobium limicola homolog . This system involves:

  • Construction of a model substrate for htpX (similar to XMS1 for E. coli HtpX).

  • Detection of differential protease activities through monitoring of cleaved fragments.

  • Analysis via western blotting to detect the cleaved products.

In vitro Activity Assays:

  • Fluorogenic peptide substrates containing FRET pairs that show increased fluorescence upon cleavage.

  • Protease assays using purified membrane protein substrates, with analysis by SDS-PAGE and western blotting.

  • Mass spectrometry-based approaches to identify cleavage sites within substrate proteins.

Activity Measurement Considerations:

  • Include appropriate controls such as catalytically inactive mutants (e.g., mutations in the HEXXH motif).

  • Standardize assay conditions including temperature (typically 30-37°C), pH (typically 7.0-8.0), and zinc concentration.

  • Consider the hydrophobic nature of the protein and ensure adequate solubilization without compromising activity .

What computational approaches can be used to analyze htpX function and evolution?

Computational analysis of htpX can provide valuable insights into its function and evolutionary relationships:

Sequence Analysis Workflow:

  • Retrieve the protein sequence from UniProt (ID: B3ED81 for C. limicola htpX).

  • Perform sequence homology search using UniProt BLAST to identify related proteins.

  • Conduct physicochemical characterization using tools like ProtParam.

  • Perform multiple sequence alignment with CLUSTALW to identify conserved regions.

  • Generate molecular phylogenetics using MEGA11 to establish evolutionary relationships .

Structural Prediction:

  • Use transmembrane topology prediction tools (TMHMM, Phobius) to identify membrane-spanning regions.

  • Apply protein structure prediction tools (AlphaFold, I-TASSER) to model the three-dimensional structure.

  • Identify functional domains and catalytic residues through structural analysis.

Conservation Analysis:
Tools like ConSurf can estimate the evolutionary conservation of amino acid positions in the protein. For htpX homologs, studies have identified approximately 19 conserved & exposed residues and 38 conserved & buried residues , which may be critical for function or structural integrity.

Protein-Protein Interaction Network:
STRING database analysis can identify potential functional partners of htpX. For related proteins, partners include def, fmt, ftsH, and grpE, suggesting involvement in protein quality control networks .

How does htpX contribute to stress response mechanisms in photosynthetic bacteria?

The role of htpX in stress response mechanisms in photosynthetic bacteria like Chlorobium limicola involves several interconnected pathways:

Heat Shock Response:
As suggested by its name (htpX: high temperature protein X), the protein is likely upregulated during heat stress to manage damaged membrane proteins. This function is particularly important in photosynthetic bacteria where membrane integrity is crucial for energy generation.

Oxidative Stress Management:
Photosynthetic organisms face unique oxidative challenges due to the production of reactive oxygen species during photosynthesis. htpX may participate in removing oxidatively damaged membrane proteins, protecting the cell from further damage.

Integration with Other Quality Control Systems:
htpX functions within a broader network of protein quality control systems:

Quality Control SystemRelationship with htpXFunction in Stress Response
FtsH protease systemComplementary or redundantPrimary membrane protein quality control
DegP/HtrA proteasesParallel pathwayPeriplasmic protein quality control
Molecular chaperones (DnaK, GroEL)Upstream preventionPrevent protein misfolding
Lon proteaseCytoplasmic counterpartDegradation of cytoplasmic proteins

What methodologies can be employed to identify physiological substrates of htpX?

Identifying the natural substrates of htpX presents a significant challenge. Several complementary approaches can be employed:

Proteomics-Based Approaches:

  • Comparative Proteomics: Compare membrane proteome profiles between wild-type bacteria and htpX knockout mutants under various stress conditions.

  • SILAC or TMT Labeling: Use stable isotope labeling to quantitatively assess protein abundance changes in the presence/absence of htpX.

  • Terminal Amine Isotopic Labeling of Substrates (TAILS): Identify N-termini generated by proteolytic cleavage.

Genetic Approaches:

  • Synthetic Lethality Screening: Identify genes that become essential in an htpX deletion background.

  • Suppressor Mutation Analysis: Identify mutations that suppress phenotypes associated with htpX deletion.

  • Targeted Degradation Assays: Express candidate substrates with reporters and monitor their stability in the presence/absence of htpX.

Structural Biology Approaches:

  • Crosslinking Mass Spectrometry: Capture transient interactions between htpX and substrate proteins.

  • Cryo-EM Analysis: Visualize htpX-substrate complexes at near-atomic resolution.

Bioinformatic Prediction:

  • Motif Analysis: Identify common sequence or structural features in known substrates.

  • Co-evolution Analysis: Identify proteins that show evolutionary correlation with htpX across bacterial species.

The combination of these approaches increases the likelihood of identifying authentic physiological substrates and understanding the substrate specificity determinants of htpX.

How can site-directed mutagenesis be utilized to study structure-function relationships in htpX?

Site-directed mutagenesis is a powerful tool for investigating the structural and functional properties of htpX:

Key Residues for Mutagenesis:

  • Catalytic Residues: The HEXXH motif contains critical histidine residues that coordinate zinc and facilitate catalysis. Mutation of these residues should abolish proteolytic activity.

  • Zinc-Binding Sites: Additional residues that coordinate zinc can be identified and mutated to confirm their role.

  • Transmembrane Domains: Mutations that alter hydrophobicity or helix-packing can provide insights into membrane integration.

  • Conserved Exposed Residues: The 19 conserved & exposed residues identified through ConSurf analysis are prime candidates for mutagenesis to study substrate recognition .

Experimental Design for Mutagenesis Studies:

  • Generate point mutations using PCR-based techniques.

  • Express and purify mutant proteins using the same conditions as wild-type.

  • Assess proper folding and membrane integration using circular dichroism spectroscopy and fluorescence-based techniques.

  • Measure proteolytic activity using the in vivo assay system described previously .

  • Evaluate substrate binding capacity through pull-down assays or surface plasmon resonance.

Application of the HtpX Model Substrate Assay:
The established in vivo semiquantitative protease activity assay system is particularly valuable for assessing the effects of mutations. This system has been shown to enable detection of differential protease activities of HtpX mutants carrying mutations in conserved regions , making it ideal for structure-function studies.

How can researchers address the solubility and stability issues common with membrane proteases like htpX?

Membrane proteases present unique challenges for biochemical and structural studies due to their hydrophobic nature. Here are methodological solutions:

Solubilization Strategies:

  • Detergent Screening: Systematically test different detergents (non-ionic, zwitterionic, and mild ionic) at various concentrations to identify optimal solubilization conditions.

  • Detergent-Lipid Mixtures: Addition of lipids (e.g., E. coli total lipid extract) to detergent solutions can enhance stability.

  • Nanodiscs or Lipid Nanodiscs: Reconstitute htpX into nanodiscs composed of membrane scaffold proteins and lipids to maintain a native-like environment.

  • Amphipols: These amphipathic polymers can stabilize membrane proteins in solution without free detergent.

Protein Engineering Approaches:

  • Truncation Constructs: Remove non-essential hydrophobic domains while retaining catalytic function.

  • Fusion Partners: Add solubility-enhancing tags (e.g., MBP, SUMO) that can be removed after purification.

  • Thermostabilizing Mutations: Introduce mutations that increase stability without affecting function.

Storage and Handling Recommendations:

  • Store the purified protein in Tris-based buffer with 50% glycerol at -20°C/-80°C .

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

  • Add stabilizing agents such as zinc (for metalloproteases) and reducing agents to prevent oxidation.

  • When working with the protein, maintain it at 4°C and minimize exposure to room temperature.

What controls are essential for validating htpX activity in experimental systems?

Robust controls are crucial for ensuring the validity and specificity of htpX activity measurements:

Essential Controls for Activity Assays:

Control TypeDescriptionPurpose
Negative Controls1. Catalytically inactive mutant (H→A in HEXXH motif)
2. htpX knockout/deletion strain
3. Reactions with EDTA to chelate zinc
Confirm that observed proteolysis is due to htpX activity
Positive Controls1. Commercial proteases with known activity
2. Well-characterized recombinant htpX homolog from E. coli
Validate assay conditions and reagents
Specificity Controls1. Non-substrate proteins
2. Proteins with modified cleavage sites
Confirm substrate specificity
System Controls1. Empty vector controls
2. Non-induced controls
3. Wild-type strain controls
Control for expression system effects

Validation Methodologies:

  • Complementation Assays: Confirm that phenotypes of htpX deletion can be rescued by expressing wild-type htpX but not catalytically inactive mutants.

  • Dose-Dependency: Demonstrate that proteolytic activity correlates with htpX concentration.

  • Inhibitor Studies: Show that metalloprotease inhibitors block activity in a specific manner.

  • Time-Course Analysis: Establish the kinetics of substrate degradation to confirm enzymatic process.

How can researchers differentiate between direct and indirect effects of htpX in cellular studies?

Distinguishing direct from indirect effects is a common challenge in studying proteases like htpX:

Direct Interaction Detection Methods:

  • In vitro Reconstitution: Demonstrate direct proteolysis using purified components.

  • Site-Specific Crosslinking: Use photo-activatable or chemical crosslinkers positioned at candidate cleavage sites.

  • Trap Mutants: Engineer "substrate-trapping" htpX variants that bind but don't cleave substrates.

  • Mass Spectrometry: Identify specific cleavage sites consistent with direct proteolysis.

Kinetic Approaches:

  • Pulse-Chase Analysis: Monitor degradation rates of potential substrates with short time intervals after htpX induction.

  • Rapid Induction Systems: Use tightly controlled induction systems to activate htpX expression and monitor immediate effects.

Genetic Strategies:

  • Epistasis Analysis: Determine the genetic relationship between htpX and other quality control components through double-knockout studies.

  • Dependency Tests: Assess whether effects of htpX require other cellular factors by conducting studies in various genetic backgrounds.

Computational Prediction Validation:

  • Compare experimental results with computational predictions of htpX substrates.

  • Use machine learning approaches to identify features that distinguish direct vs. indirect targets.

How does Chlorobium limicola htpX compare structurally and functionally to homologs in other bacterial species?

Comparative analysis reveals important insights into the conservation and specialization of htpX across bacterial species:

Physicochemical Properties Comparison:

Bacterial SpeciesAmino Acid LengthpI RangeHydrophobicityThermal Stability
Chlorobium limicola291Slightly acidic to basicHighStable
E. coli~300Slightly basicHighStable
Agrobacterium tumefaciens321BasicHighStable
Polynucleobacter necessarius279-336Slightly acidic to basicHighStable

These proteins are generally hydrophobic, consistent with their membrane localization, and show thermal stability that allows them to function in various environmental conditions .

Evolutionary Relationship:
Phylogenetic analysis suggests that Polynucleobacter necessarius was the ancestor of many of the studied organisms with htpX homologs, and related organisms are more or less clustered together . This suggests they might share common pathogenic strategies and substrate preferences.

Functional Conservation and Specialization:
While the core proteolytic function appears conserved, the specific substrates and regulatory mechanisms may differ based on the ecological niche and metabolic requirements of each organism. In photosynthetic bacteria like Chlorobium limicola, htpX may be particularly important for quality control of photosynthetic membrane proteins, while in non-photosynthetic bacteria, it may focus on other membrane protein complexes.

What emerging technologies show promise for advancing htpX research?

Several cutting-edge technologies hold significant potential for deepening our understanding of htpX:

Cryo-Electron Microscopy:
Recent advances in cryo-EM enable structural determination of membrane proteins in near-native environments, potentially revealing the three-dimensional architecture of htpX and its interaction with substrates at unprecedented resolution.

Proteomics Innovations:

  • Proximity-Dependent Labeling: Techniques like BioID or APEX can identify proteins in close proximity to htpX in living cells.

  • Top-Down Proteomics: Analysis of intact proteins can provide a complete picture of proteolytic products.

  • Degradomics: Systematic identification of all cleavage events in a cell under specific conditions.

Single-Molecule Techniques:

  • Single-Molecule FRET: Monitor conformational changes during substrate binding and catalysis.

  • Nanopore Analysis: Detect individual proteolytic events by measuring changes in electrical conductance.

Genome Editing Advances:
CRISPR-Cas9 systems allow for precise manipulation of htpX and related genes, facilitating the creation of conditional knockouts, tagged variants, and specific mutations in diverse bacterial species.

Computational Biology Approaches:

  • Molecular Dynamics Simulations: Model the dynamics of htpX in a lipid bilayer environment.

  • Machine Learning: Predict substrates and cleavage sites based on known examples.

  • Systems Biology: Model the entire membrane protein quality control network to understand htpX's role.

What are the implications of htpX research for understanding bacterial pathogenesis and developing new antimicrobial strategies?

Research on bacterial proteases like htpX has significant implications for both basic understanding of bacterial physiology and applied antimicrobial development:

Pathogenesis Mechanisms:
Protease HtpX homologs have been associated with endodontic infections, and structural or functional disturbances may lead to infections . Understanding the role of htpX in maintaining membrane homeostasis could provide insights into how bacteria adapt to host environments during infection.

Antimicrobial Resistance:
Membrane protein quality control systems like htpX may contribute to bacterial resilience under antibiotic stress. Some bacterial HtpX homologs are known to be induced by membrane damage caused by aminoglycoside antibiotics , suggesting a potential role in the stress response to antimicrobial treatment.

Therapeutic Targeting Potential:
The essentiality of protein quality control for bacterial survival makes htpX and related systems attractive targets for antimicrobial development. Several approaches could be considered:

  • Direct Inhibition: Develop small-molecule inhibitors that specifically target the catalytic site of htpX.

  • Allosteric Modulation: Identify compounds that bind to regulatory sites and alter htpX function.

  • Substrate Mimicry: Design peptides that compete with natural substrates but resist degradation.

  • Combination Therapy: Target htpX in combination with antibiotics that damage membrane proteins to prevent bacterial recovery.

Diagnostic Applications:
Understanding the conservation and expression patterns of htpX across bacterial species could lead to new diagnostic approaches for identifying specific bacterial infections, particularly in polymicrobial contexts like endodontic infections.

The results from computational proteomic studies and functional characterization of htpX could ultimately be used in the development of effective therapeutic strategies targeting bacterial membrane protein quality control systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.