Recombinant Chlorobium limicola Undecaprenyl-diphosphatase (uppP)

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Chlorobium limicola?

Undecaprenyl-diphosphatase (uppP) is an enzyme with EC number 3.6.1.27, also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase. In Chlorobium limicola, this enzyme plays a critical role in cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate . This reaction is essential for the recycling of the lipid carrier involved in peptidoglycan synthesis.

The enzyme is encoded by the uppP gene (locus name Clim_1735) and consists of 283 amino acids . It functions within the bacterial membrane, where it contributes to bacterial resistance against antimicrobials like bacitracin that target cell wall synthesis. Structurally, uppP contains multiple transmembrane domains, with hydrophobic regions that anchor it within the cell membrane, allowing it to access its lipid substrate.

How does Chlorobium limicola uppP compare with undecaprenyl diphosphatases from other bacterial species?

Chlorobium limicola uppP shares functional similarities with undecaprenyl diphosphatases from other bacterial species, though with distinct structural features. While all these enzymes catalyze the same reaction in cell wall biosynthesis, the Chlorobium limicola version has specific amino acid sequences that may affect its activity, substrate specificity, and regulation.

When comparing with similar enzymes, such as those studied in E. coli, the Chlorobium limicola uppP contains characteristic membrane-spanning domains and active site configurations. The amino acid sequence (MNLFEAVILGIVQGLTEFLPISSTAHLRIIPALAGWKDPGAAFTAIVQIGTLAAVLIYFF RDITAIVREVVAGILKGRPLGTTEAKMGWMIAAGTIPIVIFGLLFKNEIETSLRSLYWIS GALIGLALLLTIAEKRMKNQLRQGVTMKSMENIGWKDALLIGLIQSIALIPGSSRSGVTI TGGLFLNLSRETAARFSFLLSLPSVLAAGVFQLYKSWDLIISSPDNLIAIIVATIVSGIV GYASIAFLLNYLKSHTTSVFIIYRLLLGSGILLmLATGmLPAT) reveals hydrophobic regions consistent with its membrane-integrated nature .

Unlike some undecaprenyl diphosphatases from other species, the Chlorobium limicola enzyme may have evolved specific adaptations for functioning in the distinct cellular environment of this green sulfur bacterium, which utilizes the reductive tricarboxylic acid cycle for carbon fixation .

What are the optimal expression systems for producing recombinant Chlorobium limicola uppP?

The choice of expression system for recombinant Chlorobium limicola uppP depends on research objectives and downstream applications. Based on recombinant protein expression research, several systems can be considered:

Escherichia coli Expression System:
E. coli remains the most widely used system for recombinant protein expression due to its rapid growth, high yields, and genetic tractability . For uppP expression in E. coli, consider the following parameters:

• Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains are particularly suitable for membrane proteins like uppP.

• Vector design: Vectors containing T7 or tac promoters with appropriate fusion tags (His-tag, MBP, or SUMO) can enhance solubility.

• Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve proper folding of membrane proteins .

Yeast Expression System:
For cases where E. coli expression results in inclusion bodies or inactive protein, yeast systems offer an alternative:

• Pichia pastoris or Saccharomyces cerevisiae can provide proper membrane insertion and post-translational modifications.

• These systems are particularly valuable when eukaryotic-like features are required for protein functionality .

Cell-Free Expression Systems:
For difficult-to-express membrane proteins like uppP, cell-free systems offer advantages:

• Eliminate cellular toxicity issues

• Allow direct incorporation into artificial membranes or nanodiscs

• Provide better control over the expression environment

How can researchers optimize culture conditions to enhance uppP solubility and prevent inclusion body formation?

Optimizing culture conditions is critical for obtaining soluble recombinant Chlorobium limicola uppP. The following methodological approaches have proven effective:

Temperature Optimization:

• Lower the growth temperature to 16-20°C after induction to slow protein synthesis and improve folding kinetics.

• Implement a gradual temperature reduction protocol (e.g., 37°C for growth, 25°C during induction, then 16°C for expression) .

Media Formulation:

• Supplement with osmolytes like betaine (1-2.5 mM) to stabilize protein structure.

• Maintain pH at approximately 6.0 during expression.

• Add L-arginine (50-200 mM) to improve protein solubility .

Induction Parameters:

• Use lower inducer concentrations (0.1-0.5 mM IPTG for lac-based systems).

• Implement auto-induction media for gradual protein expression.

• Consider longer expression times (24-48 hours) at reduced temperatures.

Co-expression Strategies:

• Co-express chaperones (GroEL/GroES, DnaK/DnaJ) to assist in proper protein folding.

• Consider co-expression with membrane integration facilitators for improved membrane insertion.

Table 1: Optimization Parameters for Recombinant uppP Expression

What are the most effective purification strategies for recombinant Chlorobium limicola uppP?

Purifying recombinant Chlorobium limicola uppP requires specialized techniques due to its membrane-associated nature. A comprehensive purification protocol involves:

Membrane Extraction:

• Harvest cells and disrupt using sonication or French press in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 10% glycerol.

• Isolate membrane fractions through differential centrifugation (40,000-100,000×g).

• Solubilize membranes using a detergent screen to identify optimal solubilization conditions. Common detergents include n-dodecyl-β-D-maltoside (DDM; 1-2%), n-octyl-β-D-glucoside (1-2%), or digitonin (1%).

Affinity Chromatography:
For His-tagged uppP constructs:

• Bind the solubilized protein to Ni-NTA resin in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and 0.05-0.1% detergent.

• Wash extensively with the same buffer containing 20-40 mM imidazole.

• Elute with buffer containing 250-300 mM imidazole.

Size Exclusion Chromatography:

• Further purify using gel filtration to remove aggregates and obtain homogeneous protein.

• Use a Superdex 200 column equilibrated with 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and 0.05% detergent.

Storage Conditions:
Store purified uppP in 50% glycerol-containing buffer at -20°C for short-term or -80°C for long-term storage, as indicated for similar proteins .

What analytical methods are most suitable for characterizing the structural and functional properties of purified uppP?

Comprehensive characterization of uppP requires multiple analytical techniques:

Functional Assays:

• Enzymatic Activity: Measure dephosphorylation activity using synthetic undecaprenyl pyrophosphate substrates and detect released phosphate using malachite green or similar colorimetric assays.

• Inhibition Studies: Evaluate the effects of known undecaprenyl pyrophosphate phosphatase inhibitors like bacitracin.

Structural Analyses:

• Circular Dichroism (CD): Assess secondary structure composition and thermal stability.

• Limited Proteolysis: Identify flexible regions and domain boundaries.

• X-ray Crystallography: If crystals can be obtained, determine high-resolution structure. Similar approaches have been successful for related bacterial membrane proteins .

• Cryo-EM: Alternative approach for structural determination without crystallization.

Biophysical Characterization:

• Dynamic Light Scattering (DLS): Evaluate size distribution and potential aggregation.

• Thermal Shift Assays: Assess protein stability under various conditions.

• Surface Plasmon Resonance (SPR): Determine binding kinetics with potential ligands or inhibitors.

Molecular Dynamics:
Computational approaches like those used for undecaprenyl pyrophosphate synthase can identify rare conformational states and potential binding pockets .

How can researchers develop site-directed mutagenesis studies to investigate the catalytic mechanism of Chlorobium limicola uppP?

Developing a comprehensive site-directed mutagenesis strategy for Chlorobium limicola uppP requires systematic identification of critical residues and careful experimental design:

Critical Residue Identification:

• Perform sequence alignment with characterized undecaprenyl diphosphatases to identify conserved residues.

• Use structural models (homology models if crystal structure unavailable) to identify potential catalytic and substrate-binding residues.

• Focus on charged residues (Asp, Glu, His, Lys, Arg) within transmembrane regions that might participate in phosphate hydrolysis.

Mutagenesis Strategy:

• Design primers for QuikChange or overlap extension PCR to introduce specific mutations.

• Create a library of single mutants for key residues, focusing on conservative substitutions first (e.g., Asp→Glu, Lys→Arg).

• For critical residues, create a range of substitutions with different properties (charged→neutral→hydrophobic).

Functional Analysis Pipeline:

• Express mutant proteins using optimized conditions established for the wild-type enzyme.

• Purify mutants using identical protocols to ensure comparable results.

• Conduct enzyme kinetics (kcat, KM) for each mutant compared to wild-type.

• Perform thermal stability assays to distinguish between catalytic effects and structural destabilization.

Structural Validation:
Combine mutagenesis with structural studies to confirm the role of specific residues:

• Crystallize select mutants to observe structural changes.

• Use hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics.

What systems biology approaches can be applied to understand the metabolic context of uppP in Chlorobium limicola?

Understanding uppP in its broader metabolic context requires integrative systems biology approaches:

Transcriptomic Analysis:

• Perform RNA-seq under conditions that modulate cell wall synthesis (e.g., different growth phases, stress conditions).

• Identify genes co-regulated with uppP to establish functional networks.

• Map transcriptional responses to understand uppP regulation in response to environmental changes.

Metabolomic Profiling:

• Use two-dimensional NMR spectroscopy to evaluate the metabolic profile under conditions that affect uppP expression or activity .

• Identify metabolites that accumulate or deplete when uppP function is altered.

• Track flux through cell wall biosynthesis pathways using isotope-labeled precursors.

Protein-Protein Interaction Studies:

• Perform pull-down assays with tagged uppP to identify interaction partners.

• Use bacterial two-hybrid systems to confirm specific interactions.

• Apply crosslinking mass spectrometry to capture transient interactions within the membrane environment.

Integrative Modeling:

• Develop computational models incorporating uppP into the wider metabolic network of Chlorobium limicola.

• Simulate effects of uppP modulation on cell wall biosynthesis flux.

• Use constraint-based modeling to predict metabolic adaptations to uppP perturbations.

How should researchers address contradictory data when studying recombinant Chlorobium limicola uppP?

When encountering contradictory data in uppP research, a systematic approach to resolution is essential:

Comprehensive Data Examination:

• Thoroughly examine all experimental data to identify specific discrepancies and patterns that contradict the initial hypothesis .

• Compare results with existing literature on related undecaprenyl diphosphatases and membrane proteins.

• Pay particular attention to outliers that may provide insight into unexpected protein behavior .

Methodological Reassessment:

• Evaluate expression and purification protocols for potential artifacts.

• Consider whether the chosen detergent affects enzyme activity or stability.

• Assess whether the recombinant construct (including tags and fusion partners) influences protein behavior.

Alternative Hypothesis Development:
Formulate alternative explanations for contradictory results:

• Consider allosteric regulation mechanisms not previously identified.

• Evaluate potential post-translational modifications affecting activity.

• Assess if the protein exists in multiple conformational states with different activities .

Validation Experiments:
Design targeted experiments to resolve contradictions:

• Use orthogonal assay methods to validate activity measurements.

• Apply advanced structural techniques to identify conformational heterogeneity.

• Test activity under varying conditions (pH, temperature, ionic strength) to identify conditional factors.

As noted in research on unexpected data, contradictions often lead to new discoveries and avenues for further investigation .

What bioinformatic approaches are most valuable for predicting and improving the solubility of recombinant Chlorobium limicola uppP?

Multiple bioinformatic strategies can be employed to predict and enhance uppP solubility:

Sequence-Based Solubility Prediction:

• Apply established tools like PROSO II and SOLpro that analyze sequence-specific factors including folding propensity, residue charge, cysteine fractions, and hydrophilicity .

• Use these predictions as a preliminary resource to understand potential folding patterns.

Surface Residue Analysis:

• Identify patches of positively charged residues and hydrophobic surface residues that may impact aggregation.

• Calculate the ratio of hydrophobic to polar amino acids on the protein surface to predict solubility in aqueous environments .

• Consider strategic mutations to alter surface properties without disrupting function.

Fusion Partner Selection:

• Use sequence-based prediction methods to evaluate plasmid design options with various fusion carrier proteins.

• Rank potential fusion partners (e.g., NusA, GrpE, thioredoxin) based on predicted solubility enhancement .

Structural Modeling:

• Generate homology models based on related proteins with known structures.

• Use models to identify poorly folded regions or exposed hydrophobic patches.

• Apply molecular dynamics simulations to predict flexibility and potential aggregation-prone regions.

Table 2: Bioinformatic Tools for uppP Solubility Analysis

What are the common challenges in expressing recombinant Chlorobium limicola uppP and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant membrane proteins like uppP:

Challenge 1: Inclusion Body Formation
Methodological solutions:

• Lower expression temperature to 16-20°C following induction.

• Reduce inducer concentration to 0.1-0.2 mM IPTG.

• Co-express with molecular chaperones like GroEL/GroES or trigger factor.

• Consider fusion partners such as MBP, SUMO, or NusA that enhance solubility .

Challenge 2: Protein Toxicity to Host Cells
Methodological solutions:

• Use tight expression control with glucose repression in lac-based systems.

• Employ specialized E. coli strains like C41(DE3) or C43(DE3) designed for toxic protein expression.

• Consider cell-free expression systems that circumvent toxicity issues.

Challenge 3: Low Expression Yield
Methodological solutions:

• Optimize codon usage for the expression host.

• Evaluate different promoter systems (T7, tac, ara) for optimal expression.

• Implement fed-batch cultivation to achieve higher cell densities.

• Screen multiple constructs with varying N- and C-terminal boundaries.

Challenge 4: Improper Membrane Integration
Methodological solutions:

• Consider expression systems with robust membrane protein synthesis machinery.

• Evaluate various detergents for optimal extraction efficiency.

• Consider expression as a GFP fusion to monitor proper folding and membrane insertion.

How can researchers design experiments to assess the enzymatic activity of recombinant Chlorobium limicola uppP?

Designing robust activity assays for uppP requires consideration of the membrane-associated nature of the enzyme and its specific catalytic function:

Substrate Preparation:

• Synthesize or obtain undecaprenyl pyrophosphate (UPP) substrate.

• Consider using fluorescently labeled or radioactive substrates for increased sensitivity.

• Prepare substrate micelles or incorporate into liposomes to mimic the native membrane environment.

Activity Assay Development:

• Phosphate Release Assay:

  • Monitor released inorganic phosphate using malachite green reagent.

  • Optimize detergent concentration to maintain enzyme activity while solubilizing the substrate.

  • Establish a standard curve with known phosphate concentrations.

• HPLC-Based Assay:

  • Directly monitor the conversion of UPP to undecaprenyl phosphate.

  • Optimize separation conditions to distinguish substrate from product.

  • Use UV detection or radiometric detection for quantification.

• Coupled Enzyme Assay:

  • Link phosphate release to NADH oxidation via commercially available enzymes.

  • Monitor absorbance change at 340 nm in real-time.

Reaction Condition Optimization:

• Perform pH optimization (typically pH 5.5-8.0).

• Test various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) as potential cofactors.

• Optimize detergent type and concentration for maximum activity.

• Determine temperature optimum and stability profile.

Kinetic Analysis:

• Determine KM and Vmax under optimized conditions.

• Analyze the effects of potential inhibitors including bacitracin.

• Test substrate specificity using structural analogs of UPP.

What emerging technologies show promise for advancing research on Chlorobium limicola uppP?

Several cutting-edge technologies offer new avenues for uppP research:

Cryo-Electron Microscopy:
The advancement of cryo-EM for membrane proteins provides opportunities to determine the structure of uppP without crystallization, potentially revealing conformational states important for catalysis and regulation.

Native Mass Spectrometry:
This technology allows analysis of intact membrane protein complexes with bound lipids and potential interaction partners, offering insights into the native state of uppP.

Single-Molecule Techniques:
Approaches like FRET and force spectroscopy can provide dynamic information about conformational changes during catalysis, offering insights beyond static structural information.

Genome Editing in Chlorobium limicola:
Development of CRISPR-Cas9 systems optimized for Chlorobium limicola would allow in vivo studies of uppP function through precise genetic manipulation.

Artificial Intelligence for Protein Structure Prediction:
Tools like AlphaFold2 can generate highly accurate structural models of uppP, facilitating rational design of experiments even in the absence of experimental structures.

Nanodiscs and Lipid Cubic Phase Systems:
These technologies provide native-like membrane environments for biochemical and structural studies of membrane proteins like uppP.

How might research on Chlorobium limicola uppP contribute to our understanding of bacterial cell wall biosynthesis and antimicrobial resistance?

Research on Chlorobium limicola uppP has significant implications for broader scientific understanding:

Evolutionary Insights:
Studying uppP from Chlorobium limicola, a photosynthetic green sulfur bacterium, provides comparative insights into how cell wall biosynthesis pathways evolved across diverse bacterial lineages. This comparison is particularly valuable given Chlorobium's distinct metabolism involving the reductive tricarboxylic acid cycle for carbon fixation .

Novel Antimicrobial Targets:
Understanding the structure-function relationships of uppP could reveal unique features that might be exploited for developing new antimicrobials. Since undecaprenyl diphosphatase is a key enzyme in peptidoglycan synthesis, it represents a promising target for antibacterial development.

Resistance Mechanisms:
As a bacitracin resistance protein , studying uppP provides insights into how bacteria develop resistance to antimicrobials targeting cell wall synthesis. This knowledge could inform strategies to overcome or circumvent resistance mechanisms.

Comparative Biochemistry:
Comparing the catalytic mechanisms of uppP from Chlorobium limicola with those from pathogenic bacteria may reveal species-specific features that could be exploited for selective inhibition.

Bacterial Physiology: Research on uppP contributes to our understanding of how bacteria regulate cell wall synthesis in response to environmental conditions, potentially revealing new regulatory mechanisms and stress responses.