Recombinant Chlorobium phaeobacteroides ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

ATP synthase, or F1FO-ATP synthase, is essential for the survival of mycobacteria, including both tuberculosis (TB) and nontuberculous mycobacteria (NTM), and is therefore considered a viable drug target . ATP synthase is a protein complex that harnesses the potential energy of the thylakoid membrane to produce a rotary force by binding and dissociating with H+ ions . It converts potential energy into biologically usable chemical energy, specifically ATP .

Structure and Function

ATP synthase consists of two main components: F1 and Fo . The Fo component is hydrophobic and embedded in the membrane, while the F1 component is hydrophilic and exposed on the thylakoid membrane's surface .

F1 Component

  • Composed of five subunits: α, β, γ, δ, and ε

  • Has a final structure that includes three α subunits, three β subunits, and one each of the γ, δ, and ε subunits (α3β3γδε)

  • Uses the rotary force generated by Fo to catalyze ATP synthesis from ADP and inorganic phosphate (Pi)

Fo Component

  • Composed of three subunits: a, b, and c, which form ab2cn

  • In chloroplasts, the c-ring contains 14 c subunits, while in cyanobacteria, it has 13–15 c subunits

  • The interaction between the a and c subunits creates the proton channel, which is made up of polar and charged amino acids in the a subunit that make the proton channel hydrophilic and facilitate the flow of H+

  • Converts the potential energy of the thylakoid membrane into a rotary force by binding and dissociating with H+ ions

Assembly in Cyanobacteria and Chloroplasts

The assembly of ATP synthase involves three main steps :

  1. Assembly of the F1 complex

  2. Assembly of the Fo complex

  3. Linkage of F1 and Fo to form the complete ATP synthase complex

In chloroplasts, the initial and crucial step in the assembly of the F1 complex is the dimerization of the α and β subunits . There are two hypotheses regarding the subsequent assembly of the chloroplast F1 complex :

  • The αβ dimer combines with the γ subunit to form an αβγ trimer, which then interacts with two other αβ dimers to form an α3β3γ complex

  • The αβ dimer first interacts with two additional αβ dimers, forming an α3β3 hexamer, which then binds to the γ subunit, resulting in an α3β3γ complex

The intermediate complexes and assembly steps of Fo are poorly understood, and further research is needed to explore how the F1 and Fo complexes are connected and if the δ subunit plays a key role in this process . There are few publications on the assembly of ATP synthases in cyanobacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Cpha266_2707; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain DSM 266)
Target Names
atpF
Target Protein Sequence
MLTSGVILLNGGLLSPNPGLIFWTTVSFVIVLLILRKLAWGPIISALEEREKGIQSSIDR AHKAKDEAEEILRKNRELLAKADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMISMAK EEIEQEKRRALDVLRNEVAELAVMGAEKIIKTSLDADMQKKIVDSMIQDLSTKRN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core, and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, through a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the atpF subunit contribute to ATP synthase function in green sulfur bacteria?

In green sulfur bacteria like Chlorobium phaeobacteroides, the atpF subunit (subunit b) serves as a critical structural component of the peripheral stator unit that connects the membrane-embedded F0 motor to the catalytic F1 head. This stator prevents the F1 portion from rotating with the central rotor, thereby enabling the conversion of the rotational energy into conformational changes in the F1 head that drive ATP synthesis.

The flexible peripheral stalk, of which atpF is a key component, redistributes differences in torsional energy across unequal steps in the rotation cycle, which is essential for the efficient coupling of proton translocation to ATP synthesis . In green sulfur bacteria, which often inhabit low-light, anaerobic environments, efficient energy conversion is particularly crucial for survival and metabolism.

How do the properties of atpF from Chlorobium phaeobacteroides compare to homologous proteins from other bacteria?

The atpF protein from Chlorobium phaeobacteroides shares structural and functional similarities with homologous proteins from other bacterial species, but also exhibits distinct characteristics reflective of its ecological niche adaptation. Green sulfur bacteria thrive in anaerobic, sulfide-rich environments with limited light, which has influenced the evolution of their energy-generating systems.

Comparative analysis reveals that while the core function of forming part of the peripheral stalk is conserved, the atpF protein from C. phaeobacteroides has sequence variations that may contribute to stability under its native conditions. Unlike some thermophilic bacteria like Chlorobium tepidum, which have adaptations for higher temperature environments, C. phaeobacteroides atpF is optimized for mesophilic conditions .

These differences are evident when comparing sequence homology and thermal stability profiles across species:

SpeciesatpF LengthNotable FeaturesEcological Niche
C. phaeobacteroides175 aaStandard mesophilic stabilityAnaerobic, low light environments
C. tepidumSimilarEnhanced thermostabilityModerate thermophilic sulfide springs
E. coliSimilarWell-characterized modelDiverse environments, mesophilic

What expression systems are most effective for producing recombinant Chlorobium phaeobacteroides atpF protein?

For recombinant expression of Chlorobium phaeobacteroides atpF, Escherichia coli-based expression systems have proven most effective, particularly for research purposes. The protein is typically expressed as a His-tagged fusion protein in E. coli, which facilitates downstream purification .

The methodology involves:

  • Gene cloning and vector construction:

    • Amplification of the atpF gene from C. phaeobacteroides genomic DNA

    • Insertion into an expression vector containing an N-terminal His-tag sequence

    • Transformation into an appropriate E. coli strain (typically BL21(DE3) or derivatives)

  • Expression conditions optimization:

    • Induction using IPTG (typically 0.5-1.0 mM)

    • Growth temperature adjustment (often lowered to 25-30°C post-induction)

    • Culture duration optimization (typically 4-16 hours post-induction)

  • Post-expression processing:

    • Cell harvesting by centrifugation

    • Lysis using mechanical or chemical methods

    • Initial clarification by centrifugation

This approach yields recombinant protein suitable for structural and functional studies, although expression levels may vary depending on specific conditions employed.

What are the best methods for purifying recombinant His-tagged atpF protein to ensure high purity and activity?

Purification of His-tagged atpF protein to high purity while maintaining activity requires a strategic approach:

  • Initial capture by immobilized metal affinity chromatography (IMAC):

    • Ni-NTA resin is most commonly used

    • Binding buffer typically contains 20-50 mM Tris or phosphate buffer (pH 7.5-8.0), 300-500 mM NaCl, and 10-20 mM imidazole

    • Washing with increasing imidazole concentrations (20-50 mM) removes non-specifically bound proteins

    • Elution with 250-300 mM imidazole yields enriched target protein

  • Secondary purification (if needed):

    • Size exclusion chromatography separates monomeric protein from aggregates

    • Ion exchange chromatography can provide additional purification

    • For atpF specifically, a buffer containing 10-20 mM Tris (pH 8.0) with 100-150 mM NaCl works well for size exclusion

  • Quality assessment:

    • SDS-PAGE analysis should show >90% purity

    • Western blotting using anti-His antibodies confirms identity

    • Mass spectrometry can verify intact mass and sequence coverage

  • Buffer exchange and storage:

    • Final protein can be exchanged into Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Addition of 5-50% glycerol improves long-term stability

    • Aliquoting and storage at -20°C or -80°C prevents degradation from freeze-thaw cycles

These methods provide a systematic approach to obtaining high-purity, active atpF protein suitable for downstream applications.

How can researchers troubleshoot low expression yields of recombinant atpF protein?

When confronting low expression yields of recombinant atpF protein, researchers should implement a systematic troubleshooting approach:

  • Codon optimization analysis:

    • C. phaeobacteroides uses different codon preferences than E. coli

    • Analyze the atpF gene sequence for rare codons in E. coli

    • Consider synthesizing a codon-optimized gene version for improved expression

  • Expression vector and host strain evaluation:

    • Test multiple expression vectors with different promoters (T7, trc, araBAD)

    • Evaluate specialized E. coli strains like Rosetta (provides rare tRNAs) or Arctic Express (enhances folding at lower temperatures)

    • Consider using chaperon co-expression systems (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Induction parameter modification:

    • Test lower IPTG concentrations (0.1-0.5 mM) to reduce toxicity

    • Implement a temperature gradient study (15-37°C)

    • Evaluate auto-induction media which can provide gentler, higher-yielding expression

  • Protein solubility enhancement:

    • If the protein forms inclusion bodies, optimize solubilization conditions

    • Consider fusion partners like SUMO, MBP, or GST that enhance solubility

    • Test expression as smaller functional domains if full-length expression is problematic

  • Scale-up considerations:

    • Ensure adequate aeration in larger culture volumes

    • Monitor and control pH during growth

    • Implement fed-batch approaches for higher cell densities

By systematically addressing these parameters, researchers can often overcome low expression yields and obtain sufficient quantities of functional atpF protein.

What methods are effective for analyzing the interaction between atpF and other ATP synthase subunits?

Several methodological approaches are effective for investigating interactions between atpF and other ATP synthase subunits:

  • In vitro reconstitution studies:

    • Separately express and purify individual ATP synthase subunits, including atpF

    • Combine purified components in controlled conditions

    • Monitor complex formation using analytical techniques like size exclusion chromatography

    • This approach reveals which subunit combinations form stable subcomplexes and the sequence of assembly

  • Mass spectrometry-based interaction analysis:

    • LILBID-MS (Laser-Induced Liquid Bead Ion Desorption Mass Spectrometry) allows detection of intact protein complexes and their subunit composition

    • Cross-linking mass spectrometry identifies interaction interfaces between subunits

    • Native MS can determine stoichiometry and stability of protein subcomplexes

  • Surface Plasmon Resonance (SPR) and Isothermal Titration Calorimetry (ITC):

    • SPR measures real-time binding kinetics between atpF and partner subunits

    • ITC provides thermodynamic parameters of binding interactions

    • These approaches quantify binding affinities and energetics

  • Structural analysis of complexes:

    • Cryo-EM has proven particularly effective for ATP synthase complexes

    • X-ray crystallography of subcomplexes provides atomic-level interaction details

    • NMR spectroscopy for smaller components or domains can map interaction interfaces

  • FRET-based interaction studies:

    • Label atpF and potential binding partners with FRET pairs

    • Measure energy transfer efficiency to determine proximity and interaction

    • Can be performed in vitro or in cellular contexts

These methodologies provide complementary information about subunit interactions, facilitating a comprehensive understanding of atpF's role in ATP synthase assembly and function.

How does ATP concentration affect the assembly of ATP synthase containing recombinant atpF protein?

ATP concentration plays a critical role in the assembly of ATP synthase complexes containing recombinant atpF protein, as demonstrated by several studies:

  • ATP is essential for specific subunit interactions:

    • In vitro studies show that ATP/Mg²⁺ promotes specific heterodimer formation between α and β subunits

    • Without ATP/Mg²⁺, only non-specific interactions are observed between ATP synthase components

    • Mass spectrometry analyses confirm that ATP/Mg²⁺ is crucial for correct subcomplex formation

  • Concentration-dependent effects:

    • 2 mM ATP/MgCl₂ is sufficient to facilitate proper α-β heterodimer formation

    • Higher ATP concentrations (>5 mM) may not provide additional benefits and can interfere with certain purification methods

    • Size exclusion chromatography confirms that ATP/Mg²⁺ shifts elution profiles, indicating formation of defined subcomplexes

  • Assembly pathway influence:

    • ATP/Mg²⁺ is vital for the entire in vitro reconstitution process, providing complex stability

    • Without ATP/Mg²⁺, higher subcomplexes incorporating atpF fail to form

    • The assembly progresses through preformed αβ heterodimers binding to γ-subunit, eventually forming the hexameric head that allows binding of peripheral stalk components including atpF

  • Experimental evidence from different methodologies:

    • LILBID-MS shows ATP-dependent formation of specific αβ heterodimers rather than homodimers

    • SEC-HPLC demonstrates shorter elution times in presence of ATP/Mg²⁺, confirming heterodimer formation

    • Both techniques independently verify that without ATP/Mg²⁺, proper assembly fails to occur

These findings indicate that ATP serves not just as a substrate for the assembled enzyme but plays a crucial structural role during the assembly process itself.

What approaches can be used to study the redox regulation of ATP synthase complexes containing atpF?

Studying redox regulation of ATP synthase complexes containing atpF requires specialized methodologies that can detect conformational and functional changes under different redox conditions:

  • Site-directed mutagenesis of redox-sensitive residues:

    • Identify potential redox-active cysteines in atpF and partner subunits

    • Generate cysteine-to-serine mutants to disrupt redox sensitivity

    • Compare functional properties of wild-type and mutant complexes under varying redox conditions

    • This approach can pinpoint specific residues involved in redox regulation

  • Activity assays under controlled redox conditions:

    • Measure ATP synthesis/hydrolysis rates under defined redox potentials

    • Use redox couples like GSH/GSSG at varying ratios to establish specific potentials

    • Add specific redox agents (DTT, H₂O₂, diamide) to test response to reducing or oxidizing conditions

    • Correlate activity changes with structural alterations

  • Structural analysis of redox states:

    • Use cryo-EM to capture ATP synthase structures in different redox environments

    • Compare conformational changes in the peripheral stalk region containing atpF

    • Examine the γ-subunit β-hairpin redox switch that blocks rotation in oxidized state in plants

    • Determine if similar regulatory mechanisms exist in bacterial systems

  • Thiol modification and quantification:

    • Use thiol-reactive probes (maleimides, iodoacetamides) to label accessible cysteines

    • Compare labeling patterns under oxidizing vs. reducing conditions

    • Identify disulfide bonds using non-reducing vs. reducing SDS-PAGE

    • Mass spectrometry can precisely locate modified residues

  • Real-time monitoring of conformational changes:

    • Introduce fluorescent probes at strategic positions

    • Monitor FRET efficiency changes during redox transitions

    • This approach provides kinetic information about redox-dependent conformational changes

These methodologies, when applied systematically, can reveal how redox conditions affect ATP synthase assembly, stability, and function through modifications of atpF and interacting subunits.

How can researchers design experiments to investigate the role of atpF in the bioenergetics of Chlorobium phaeobacteroides?

Designing experiments to investigate atpF's role in C. phaeobacteroides bioenergetics requires a multi-faceted approach:

By integrating these approaches, researchers can comprehensively characterize how atpF contributes to the bioenergetic machinery of C. phaeobacteroides and how this supports its ecological niche adaptation.

What methods can be used to study the assembly pathway of ATP synthase complexes containing recombinant atpF?

Studying the assembly pathway of ATP synthase complexes containing recombinant atpF requires techniques that can capture intermediates and determine the sequence of assembly events:

  • Time-resolved reconstitution experiments:

    • Express and purify individual ATP synthase subunits, including atpF

    • Mix components in controlled sequence and timing

    • Sample at defined time points for analysis of subcomplexes

    • Use analytical techniques to identify assembly intermediates

    • This approach reveals the sequential order of complex formation

  • Mass spectrometry-based approaches:

    • Native mass spectrometry can detect intact subcomplexes

    • LILBID-MS provides information on composition and stoichiometry of intermediates

    • Time-course experiments reveal progression of assembly

    • These methods directly identify which subcomplexes form during assembly

  • Fluorescence-based real-time monitoring:

    • Label key subunits with fluorescent tags

    • Monitor FRET or fluorescence changes during assembly

    • Track assembly kinetics in real-time

    • This provides temporal information about the assembly process

  • Cryo-EM visualization of assembly intermediates:

    • Capture assembly states by freezing samples at different time points

    • Determine structures of assembly intermediates

    • Identify conformational changes during assembly

    • This provides structural insights into assembly progression

  • Biochemical validation using ATP-dependent assembly:

    • Use the requirement for ATP/Mg²⁺ to control assembly initiation

    • Add ATP to trigger specific assembly steps

    • Compare subcomplex formation with and without ATP

    • This confirms the ATP-dependency of specific assembly steps

Experimental evidence has shown that assembly proceeds through specific pathways:

  • αβ heterodimers form only in the presence of ATP/Mg²⁺

  • These heterodimers assemble onto the γ subunit

  • The hexameric head forms before peripheral stalk association

  • Only once the hexameric head is assembled can the δ subunit (and connected peripheral stalk containing atpF) bind

These methodologies provide complementary information about the precise sequence and requirements for ATP synthase assembly.

How can researchers address contradictory data when studying atpF function in ATP synthase complexes?

When confronted with contradictory data regarding atpF function in ATP synthase complexes, researchers should employ a systematic troubleshooting and validation approach:

By systematically addressing contradictions through these approaches, researchers can resolve discrepancies and develop a more comprehensive understanding of atpF function.

What novel approaches are emerging for studying the structure and function of recombinant ATP synthase subunits like atpF?

Several cutting-edge approaches are transforming our ability to study ATP synthase subunits like atpF:

  • Advanced cryo-EM techniques:

    • Time-resolved cryo-EM captures functional states during ATP synthesis/hydrolysis

    • High-resolution imaging (below 2.5Å) reveals detailed side-chain interactions

    • Focused classification algorithms identify rare conformational states

    • These advances allow visualization of dynamic processes in ATP synthase at unprecedented detail

  • Single-molecule biophysics:

    • Optical tweezers measure mechanical forces during ATP synthase rotation

    • FRET-based approaches track conformational changes in real-time

    • Magnetic tweezers apply controlled torque to probe mechanical properties

    • These techniques provide insights into the mechanics of energy conversion

  • In-cell structural biology:

    • Cryo-electron tomography examines ATP synthase in native cellular environments

    • In-cell NMR detects structural changes in cellular context

    • Mass photometry measures complex assembly in near-native conditions

    • These methods bridge the gap between in vitro and in vivo findings

  • Integrative modeling approaches:

    • Combine data from multiple experimental sources (cryo-EM, crosslinking-MS, FRET)

    • Use molecular dynamics simulations to model conformational dynamics

    • Implement machine learning for model refinement and validation

    • These computational approaches generate comprehensive structural models

  • Gene editing and synthetic biology tools:

    • CRISPR-Cas9 precisely modifies atpF in native context

    • Synthetic biology creates minimal ATP synthase systems with defined components

    • Optogenetic control allows temporal regulation of ATP synthase assembly

    • These genetic tools enable precise manipulation of atpF structure and function

These emerging technologies are revolutionizing our understanding of ATP synthase subunits by providing dynamic, high-resolution insights into their structure and function in increasingly native-like environments.

How can researchers optimize reconstitution protocols for functional studies of ATP synthase complexes containing recombinant atpF?

Optimizing reconstitution protocols for functional studies of ATP synthase complexes containing recombinant atpF requires attention to several critical parameters:

  • Component preparation optimization:

    • Ensure high purity (>95%) of all individual subunits through rigorous purification

    • Verify proper folding using circular dichroism or intrinsic fluorescence

    • Use freshly prepared components whenever possible to minimize aggregation

    • Employ dynamic light scattering to confirm monodispersity before reconstitution

  • Buffer composition refinement:

    • Include 2 mM ATP and MgCl₂ to promote proper complex formation

    • Optimize salt concentration (typically 100-300 mM NaCl) to balance stability and assembly

    • Maintain appropriate pH (7.5-8.0) using Tris or phosphate-based buffers

    • Consider adding stabilizing agents like glycerol (5-10%) or trehalose (3-6%)

  • Assembly sequence control:

    • Follow the established assembly pathway: first form αβ heterodimers, then add γε, followed by peripheral stalk components

    • Allow sufficient incubation time between additions (30-60 minutes) for stable intermediate formation

    • Maintain temperature control (typically 25°C) throughout the assembly process

    • Monitor intermediate formation using analytical techniques before proceeding

  • Membrane environment reconstitution:

    • For full F₁F₀ complexes, select appropriate lipids that match the native bacterial membrane

    • Use controlled detergent removal (dialysis, Bio-Beads, or cyclodextrin) for proteoliposome formation

    • Control protein:lipid ratios (typically 1:50 to 1:200 w/w) for optimal function

    • Verify membrane integrity using fluorescent probes or electron microscopy

  • Functional validation:

    • Implement multiple assays to assess different aspects of function:

      • ATP synthesis using luciferase-based detection

      • ATP hydrolysis via phosphate release assays

      • Proton pumping using pH-sensitive dyes

      • Membrane potential generation using voltage-sensitive probes

    • Compare activities to native complexes as benchmarks for successful reconstitution

By systematically optimizing these parameters, researchers can achieve functional reconstitution of ATP synthase complexes containing recombinant atpF, enabling detailed mechanistic studies of energy conversion processes.

What considerations are important when designing site-directed mutagenesis experiments for atpF functional studies?

Designing effective site-directed mutagenesis experiments for atpF functional studies requires careful planning and consideration of multiple factors:

  • Structure-informed target selection:

    • Utilize available structural data to identify functionally important regions

    • Target residues at interfaces with other subunits like α, β, or δ

    • Focus on conserved amino acids that suggest evolutionary importance

    • Consider regions with predicted conformational flexibility that may be important for function

  • Mutation design strategy:

    • Implement conservative substitutions first (e.g., Asp to Glu) to minimize structural disruption

    • Design charge reversal mutations (Asp to Lys) to test electrostatic interactions

    • Create alanine substitutions to remove side-chain interactions while maintaining backbone structure

    • Consider cysteine substitutions for subsequent labeling or crosslinking studies

    • Develop a mutation gradient from subtle to severe to characterize functional sensitivity

  • Mutagenesis controls and validation:

    • Create control mutations in non-conserved, non-functional regions

    • Design paired mutations to test compensatory effects

    • Verify all mutations by DNA sequencing before expression

    • Confirm protein expression, folding, and stability for each mutant

    • Use circular dichroism to verify that global structure is not disrupted

  • Functional assay selection:

    • Choose assays that directly probe the function affected by the mutation

    • For atpF peripheral stalk functions, assess:

      • ATP synthase assembly using native PAGE or analytical ultracentrifugation

      • Stator stability using thermal denaturation or chemical unfolding

      • Energy coupling efficiency using ATP synthesis/hydrolysis ratios

      • Subunit interaction strength using SPR or ITC

    • Implement quantitative measurements for precise phenotype characterization

  • Interpretation guidelines:

    • Establish clear thresholds for significant functional changes

    • Differentiate between structural and functional effects of mutations

    • Consider potential long-range allosteric effects beyond the mutation site

    • Integrate results across multiple mutations to build a comprehensive model

    • Validate key findings with complementary approaches (e.g., crosslinking, FRET)

By following these considerations, researchers can design and execute mutagenesis studies that provide meaningful insights into atpF structure-function relationships within the context of the ATP synthase complex.

What are the major challenges in expressing and purifying recombinant atpF protein, and how might they be addressed?

Researchers face several significant challenges when expressing and purifying recombinant atpF protein, each requiring specific mitigation strategies:

  • Low expression yield challenges:

    • Challenge: atpF often expresses poorly in heterologous systems due to its hydrophobic regions and membrane association

    • Solution approaches:

      • Implement codon optimization for the expression host

      • Use specialized expression strains like C41/C43(DE3) designed for membrane proteins

      • Explore fusion partners (SUMO, MBP, TrxA) that enhance solubility

      • Test cold-shock expression systems for improved folding

  • Protein aggregation issues:

    • Challenge: atpF may form insoluble aggregates, particularly when expressed without its partner subunits

    • Solution approaches:

      • Co-express with interaction partners like subunit δ

      • Include mild detergents (0.05% DDM or 0.5% CHAPS) in lysis buffers

      • Add stabilizing agents like arginine (50-100 mM) to prevent aggregation

      • Use on-column refolding during purification

  • Functional conformation maintenance:

    • Challenge: Maintaining the native conformation of atpF outside its complex is difficult

    • Solution approaches:

      • Include ATP and Mg²⁺ (2 mM each) in all buffers to stabilize structure

      • Use amphipols or nanodiscs to provide a membrane-like environment

      • Purify as part of a minimal subcomplex rather than in isolation

      • Validate folding using circular dichroism or intrinsic fluorescence

  • Stability during storage:

    • Challenge: Purified atpF often loses activity during storage due to aggregation or degradation

    • Solution approaches:

      • Add 5-50% glycerol or 6% trehalose to storage buffers

      • Maintain at -80°C for long-term storage; avoid repeated freeze-thaw cycles

      • Store at 4°C for up to one week for immediate use

      • Consider lyophilization with appropriate cryoprotectants for certain applications

  • Functional validation complexities:

    • Challenge: Confirming that recombinant atpF retains native functionality is difficult

    • Solution approaches:

      • Develop reconstitution assays with partner subunits

      • Implement biophysical interaction studies (SPR, ITC) to verify binding properties

      • Use structural studies (cryo-EM, SAXS) to confirm proper folding

      • Compare properties with native protein isolated from C. phaeobacteroides

By systematically addressing these challenges, researchers can significantly improve the yield, quality, and functionality of recombinant atpF protein for subsequent structural and functional studies.

How can researchers effectively investigate the specific role of atpF in proton translocation and energy coupling?

Investigating atpF's specific role in proton translocation and energy coupling requires sophisticated experimental approaches that can dissect its contribution to these processes:

  • Structure-function relationship mapping:

    • Create a library of site-specific atpF mutants targeting the stator function

    • Focus on residues at the interface with F₀ components and the c-ring

    • Assess how mutations affect proton translocation efficiency

    • Correlate structural perturbations with functional outcomes using cryo-EM

  • Proton pathway visualization and manipulation:

    • Use molecular dynamics simulations to identify potential proton transfer pathways

    • Design mutations that alter hydrophilic residues in these pathways

    • Implement pH-sensitive fluorescent probes positioned at strategic locations

    • Measure proton movement kinetics using stopped-flow spectroscopy

  • Energy coupling efficiency assessment:

    • Develop assays that simultaneously measure proton translocation and ATP synthesis

    • Calculate H⁺/ATP ratios for wild-type and mutant complexes

    • Assess how structural alterations in atpF affect coupling efficiency

    • Use artificial proton gradients of defined magnitude to quantify energy conversion

  • In vitro single-molecule approaches:

    • Reconstitute ATP synthase complexes with modified atpF into liposomes

    • Apply patch-clamp techniques to measure proton currents through single complexes

    • Use gold nanorod-based rotational measurements to assess mechanical coupling

    • Correlate proton translocation events with rotational steps and ATP synthesis

  • Torsional elasticity characterization:

    • Probe the mechanical properties of the peripheral stalk containing atpF

    • Measure torsional rigidity using magnetic tweezers or AFM-based approaches

    • Assess how atpF modifications affect the ability to withstand torsional stress

    • Correlate elasticity changes with energy coupling efficiency

  • Comparative studies across species:

    • Examine atpF from species with different H⁺/ATP ratios

    • Identify structural features that correlate with coupling efficiency

    • Create chimeric proteins to test specific domains

    • Use this information to construct a generalized model of atpF's role

These methods, especially when combined, can provide comprehensive insights into how atpF contributes to the critical energy coupling processes that enable ATP synthesis in Chlorobium phaeobacteroides.

What future research directions might advance our understanding of Chlorobium phaeobacteroides atpF and its role in bacterial bioenergetics?

Several promising research directions could significantly advance our understanding of C. phaeobacteroides atpF and its role in bacterial bioenergetics:

  • Integration of structural dynamics and functional states:

    • Apply time-resolved cryo-EM to capture conformational changes during ATP synthesis

    • Implement molecular dynamics simulations to model flexibility of the peripheral stalk

    • Develop FRET-based sensors to monitor conformational changes in real-time

    • These approaches would reveal how dynamic structural changes in atpF contribute to energy coupling

  • Evolutionary adaptation studies:

    • Conduct comparative analyses of atpF across green sulfur bacteria from different environments

    • Identify adaptive changes correlating with habitat-specific energetic challenges

    • Create chimeric proteins to test functional significance of species-specific variations

    • This would reveal how evolutionary pressures have shaped atpF structure and function

  • Development of in vivo probes and imaging:

    • Create fluorescent protein fusions for in vivo localization studies

    • Develop FRET-based sensors to monitor ATP synthase assembly in living cells

    • Apply super-resolution microscopy to examine distribution and dynamics

    • These tools would provide insights into atpF behavior in its native context

  • Synthetic biology approaches:

    • Design minimal ATP synthase systems with engineered atpF variants

    • Create orthogonal ATP synthases with modified specificity or regulation

    • Develop biosensors based on atpF conformational changes

    • These applications would both test our understanding and develop useful biotechnological tools

  • Systems-level integration:

    • Examine how ATP synthase containing atpF interacts with other bioenergetic complexes

    • Map protein-protein interactions in the context of energy metabolism

    • Develop metabolic models incorporating ATP synthase regulation

    • This would place atpF function in the broader context of cellular bioenergetics

  • Ecological and biogeochemical implications:

    • Investigate how atpF adaptations contribute to ecological fitness in natural habitats

    • Examine the role of ATP synthase efficiency in biogeochemical cycling

    • Study how environmental factors affect ATP synthase function in situ

    • This would connect molecular mechanisms to ecosystem-level processes

By pursuing these research directions, scientists can develop a comprehensive understanding of how atpF contributes to the remarkable bioenergetic adaptations that allow C. phaeobacteroides to thrive in its unique ecological niche, while potentially uncovering principles applicable to bioenergetic systems more broadly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.