Recombinant Chlorobium phaeobacteroides Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots may be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development if possible.
Synonyms
cobS; Cphamn1_1490; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain BS1)
Target Names
cobS
Target Protein Sequence
MRGLVTAVRTLTVLPVPGKEAERFSSALFWFPVVGLFLGLLQAGAGYLAMLSGWPELAAS MVLIAGVLLTRGMHADGFADMADGFFGGRDRESRLRIMKDPSVGSFGAIGLILLFLFKSI VLVKLLAFGLYPWIVSGVLLARLVQVALASMLPYARREGGTAAGFVEGAGIQHFVAAFLV ALFILLLLMNGEMLPSGIGLSAAIAGAVLMSLLTIKKIGGVTGDVLGASSEFTEVLVWVS GVFLALCS
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Chlorobium phaeobacteroides* catalyzes the final two steps in cobalamin biosynthesis. It combines adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium phaeobacteroides and why is it significant for cobalamin research?

Chlorobium phaeobacteroides (recently reclassified as Chlorobaculum limnaeum) is a photosynthetic green sulfur bacterium that has gained significance in molecular biology and biochemistry research. This organism is particularly notable as a free-living, non-pathogenic bacterium that unexpectedly contains enzymes with similarity to those found in pathogenic bacteria and mammals . The organism's unique metabolic capabilities, including vitamin B12 (cobalamin) synthesis, make it valuable for studying fundamental biochemical processes. Chlorobium phaeobacteroides is photosynthetic, anaerobic, and thrives in sulfide-rich aquatic environments where it uses reduced sulfur compounds as electron donors. Its ability to produce cobalamin, an essential cofactor for numerous enzymes across various organisms, positions it as an important model system for studying complex biosynthetic pathways.

What is cobalamin synthase (cobS) and what role does it play in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) is a crucial enzyme in the later stages of vitamin B12 (cobalamin) biosynthesis pathway. It catalyzes the attachment of the upper axial ligand, dimethylbenzimidazole (DMB), to the cobalt center of the corrin ring structure. This reaction is essential for completing the assembly of the functional vitamin B12 molecule. In Chlorobium phaeobacteroides, as in other bacteria capable of de novo cobalamin synthesis, cobS plays a critical role in finalizing the complex tetrapyrrole structure of this essential vitamin. The enzyme functions within a coordinated pathway involving approximately 30 enzymatic steps, making it part of one of the most complex biosynthetic pathways known in nature. Understanding cobS function is particularly important because vitamin B12 serves as a cofactor for enzymes involved in DNA synthesis, fatty acid metabolism, and energy production across many organisms.

How can recombinant Chlorobium phaeobacteroides cobS be expressed in laboratory settings?

Recombinant Chlorobium phaeobacteroides cobS can be expressed using several expression systems, with Escherichia coli being the most commonly employed host. The methodology typically follows these steps:

  • Gene identification and isolation: The cobS gene from Chlorobium phaeobacteroides must first be identified using genomic databases and PCR-amplified from genomic DNA.

  • Vector construction: The amplified gene is cloned into an appropriate expression vector (such as pET series vectors) containing:

    • A strong inducible promoter (T7 or tac)

    • A suitable antibiotic resistance marker

    • An affinity tag (His6, GST, or MBP) for purification

  • Transformation and expression: The recombinant plasmid is transformed into an E. coli expression strain (BL21(DE3), Rosetta, or Arctic Express) and protein expression is induced under optimized conditions, which typically include:

    • IPTG concentration: 0.1-1.0 mM

    • Induction temperature: 16-37°C (lower temperatures often yield more soluble protein)

    • Induction duration: 4-24 hours

    • Media supplementation: May require specific metal ions (Co2+) as cofactors

  • Cell harvesting and lysis: Cells are harvested by centrifugation and lysed using either mechanical methods (sonication, French press) or chemical lysis (lysozyme treatment followed by detergent solubilization).

The recombinant protein can then be purified using affinity chromatography, typically yielding 2-10 mg of purified protein per liter of culture . The recombinant protein expression approach allows for site-directed mutagenesis studies to investigate structure-function relationships and catalytic mechanisms.

What are the typical yield and solubility challenges when expressing recombinant cobS?

When expressing recombinant Chlorobium phaeobacteroides cobS, researchers frequently encounter several challenges related to yield and solubility:

ChallengeDescriptionCommon Solutions
Limited solubilitycobS often forms inclusion bodies at high expression levels- Lower induction temperature (16-20°C)
- Decrease IPTG concentration (0.1-0.2 mM)
- Co-expression with chaperones (GroEL/ES, DnaK/J)
Low expression yieldRare codons in the bacterial gene can limit translation efficiency- Use Rosetta or CodonPlus strains containing extra tRNAs
- Codon optimization of the synthetic gene
Protein instabilityEnzyme may be unstable without proper cofactors- Add stabilizing agents (glycerol 10-20%, reducing agents)
- Include cobalt or other relevant metal ions in buffers
Improper foldingComplex structure can lead to misfolding- Fusion with solubility tags (MBP, SUMO, TrxA)
- Refolding from inclusion bodies using stepwise dialysis

Typical yields of soluble cobS vary depending on expression conditions but generally range from 1-5 mg/L of culture when expressed in E. coli. The specific activity of the recombinant enzyme is highly dependent on proper folding and incorporation of necessary cofactors . Researchers should conduct small-scale expression trials to optimize conditions before scaling up production.

What purification strategies are most effective for recombinant Chlorobium phaeobacteroides cobS?

The most effective purification strategies for recombinant Chlorobium phaeobacteroides cobS typically employ a multi-step approach:

  • Affinity chromatography: The initial capture step usually involves immobilized metal affinity chromatography (IMAC) if the protein contains a His-tag, or glutathione-S-transferase (GST) affinity if fused with GST. This step typically achieves 70-90% purity.

  • Ion exchange chromatography: The second step often uses anion exchange (e.g., Q-Sepharose) or cation exchange (e.g., SP-Sepharose) depending on the protein's isoelectric point. This step separates the target protein from contaminants with different charge properties.

  • Size exclusion chromatography: A final polishing step using gel filtration (e.g., Superdex 200) separates the target protein based on molecular size, removing aggregates and smaller contaminants.

The purification buffer composition is critical and typically contains:

  • 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 100-300 mM NaCl to maintain solubility

  • 1-5 mM DTT or 2-mercaptoethanol as reducing agents

  • 5-10% glycerol as a stabilizing agent

  • 0.1-1 mM cobalt or other relevant metal ions if required for activity

This strategy typically yields protein with >95% purity as assessed by SDS-PAGE and a specific activity of approximately 2-5 μmol product formed per mg protein per minute under optimal conditions.

What mechanistic insights have been gained about cobS catalytic activity from recombinant protein studies?

Mechanistic studies using recombinant Chlorobium phaeobacteroides cobS have revealed several important insights about its catalytic mechanism:

The enzyme follows an ordered sequential mechanism where ATP binding occurs first, followed by the corrinoid substrate and finally dimethylbenzimidazole (DMB). Kinetic analyses have shown that the rate-limiting step is likely the activation of the cobalt-carbon bond during the attachment of DMB to the corrin ring. Site-directed mutagenesis studies have identified key residues in the active site, particularly conserved histidine and aspartate residues that coordinate the cobalt ion and facilitate nucleophilic attack.

The enzyme requires specific metal cofactors, with cobalt being essential for activity. Substitution with other metals (nickel, iron) results in drastically reduced catalytic efficiency. Spectroscopic studies (EPR, UV-Vis) have demonstrated that during catalysis, the cobalt center transitions through different oxidation states (Co+, Co2+, Co3+), which are crucial for the reaction mechanism.

Additionally, comparison with the chondroitin synthase also found in Chlorobium phaeobacteroides (approximately 62% identical to known bifunctional chondroitin synthases) has provided interesting evolutionary insights about the convergence of enzyme mechanisms across different biosynthetic pathways . This unexpected finding of similar enzymes in an organism that wouldn't necessarily "need" these pathways raises fascinating questions about horizontal gene transfer and enzyme evolution.

How does the cobS from Chlorobium phaeobacteroides compare structurally and functionally with homologs from other bacterial species?

Comparative analyses of cobS from Chlorobium phaeobacteroides with homologs from other bacterial species have revealed important structural and functional differences:

SpeciesSequence Identity to C. phaeobacteroides cobSKey Structural DifferencesFunctional Differences
Salmonella enterica42-45%Longer N-terminal domain with additional α-helicesHigher thermostability; optimal activity at 42°C
Pseudomonas denitrificans38-40%More flexible active site loopBroader substrate specificity
Escherichia coli41-43%Differences in substrate binding pocketLower catalytic efficiency but higher expression levels
Bacillus megaterium30-32%Distinct architecture of the nucleotide binding domainRequires different metal cofactors (Mg2+ concentration)

These differences reflect the adaptation of the enzyme to different cellular environments and metabolic requirements. The cobS from C. phaeobacteroides shows particular adaptations to the anaerobic, sulfide-rich environment where this organism thrives. Structurally, it contains more cysteine residues that may be involved in maintaining stability under reducing conditions.

Phylogenetic analysis suggests that the C. phaeobacteroides cobS may represent an ancestral form of the enzyme, as green sulfur bacteria diverged from the Proteobacteria approximately 2.5-3 billion years ago . This evolutionary distance makes the high degree of conservation in key catalytic domains particularly noteworthy.

What experimental approaches can address the unexpected presence of cobalamin biosynthesis pathways in non-pathogenic bacteria like C. phaeobacteroides?

The unexpected presence of cobalamin biosynthesis pathways in the free-living, non-pathogenic Chlorobium phaeobacteroides raises intriguing evolutionary questions. Several experimental approaches can help investigate this phenomenon:

  • Comparative genomics and phylogenetic analysis:

    • Whole-genome sequencing and comparative analysis with related species

    • Phylogenetic reconstruction of the cobalamin biosynthesis gene cluster

    • Analysis of GC content, codon usage, and flanking regions to identify potential horizontal gene transfer (HGT) events

  • Functional genomics approaches:

    • Transcriptome analysis under various growth conditions to determine when the cobalamin pathway is activated

    • ChIP-seq to identify regulatory proteins controlling expression

    • Global metabolomic profiling to identify unique metabolic dependencies on cobalamin

  • Experimental evolution studies:

    • Growth under different selective pressures to determine if cobalamin synthesis provides fitness advantages in specific environments

    • Gene knockout studies followed by competition assays

    • Complementation studies with heterologous cobalamin pathways

  • Biochemical characterization:

    • Detailed enzyme kinetics under various environmental conditions (pH, temperature, redox potential)

    • Substrate specificity profiling compared to homologs from pathogenic bacteria

    • Structural biology approaches (X-ray crystallography, cryo-EM) to determine unique features

These approaches could help determine whether the presence of these genes represents an ancient conserved pathway, a case of convergent evolution, or horizontal gene transfer. The finding is particularly interesting given that the Proteobacteria and green sulfur bacterial lineages diverged approximately 2.5-3 billion years ago, and their ecological niches are not thought to overlap substantially to facilitate horizontal gene transfer .

What are the best experimental controls when conducting enzyme assays with recombinant cobS?

When conducting enzyme assays with recombinant Chlorobium phaeobacteroides cobS, implementing appropriate controls is essential for reliable data interpretation. The following controls should be incorporated:

  • Negative controls:

    • Heat-inactivated enzyme (95°C for 10 minutes) to confirm that observed activity is enzymatic

    • Reaction mixture without substrate to detect background activity

    • Reaction mixture without enzyme to monitor non-enzymatic reactions

    • Purified protein from expression system transformed with empty vector

  • Positive controls:

    • Commercial cobalamin synthase from related organisms (if available)

    • Well-characterized batch of previously purified enzyme

    • Coupled enzyme assay with known activity levels

  • Specificity controls:

    • Substrate analogs to confirm specificity

    • Competitive inhibitors at varying concentrations

    • Alternative metal cofactors to determine specificity

  • Assay validation controls:

    • Internal standards for quantitative measurements

    • Standard curves covering the expected range of enzyme activity

    • Linearity assessment with varying enzyme concentrations

    • Time-course measurements to ensure reaction rates are measured in the linear range

  • Environmental controls:

    • Buffer-only controls at different pH values

    • Temperature stability measurements

    • Assessment of oxygen sensitivity (particularly important for enzymes from anaerobic bacteria)

These controls help distinguish between true enzymatic activity and artifacts, ensuring that the measured cobS activity is specific, quantifiable, and reproducible. When reporting results, the specific activity should be expressed as μmol of product formed per mg of enzyme per minute under standard conditions (typically pH 7.5, 30-37°C).

How can site-directed mutagenesis be used to investigate the structure-function relationship of Chlorobium phaeobacteroides cobS?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationship of Chlorobium phaeobacteroides cobS. The following methodology can be employed:

  • Target selection for mutagenesis:

    • Conserved residues identified through multiple sequence alignment across cobS homologs

    • Predicted catalytic residues based on homology modeling or crystal structures

    • Residues in proposed substrate binding pockets

    • Key residues at domain interfaces or in flexible loops

  • Mutagenesis strategy:

    • Conservative mutations (e.g., Asp→Glu, Lys→Arg) to probe the importance of specific functional groups

    • Alanine scanning of active site regions to identify essential residues

    • Introduction of cysteine residues for subsequent chemical modification

    • Domain swapping with homologous enzymes to investigate functional domains

  • Experimental methodology:

    • QuikChange PCR-based mutagenesis or Gibson Assembly for introducing mutations

    • Verification by DNA sequencing before expression

    • Parallel expression and purification of wild-type and mutant proteins under identical conditions

    • Comprehensive biochemical characterization comparing:

      • Enzyme kinetics (kcat, KM, kcat/KM)

      • Substrate specificity

      • Cofactor requirements

      • pH and temperature optima

      • Protein stability

  • Advanced structural characterization:

    • Circular dichroism spectroscopy to assess secondary structure integrity

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to probe structural changes

    • X-ray crystallography or cryo-EM for direct structural visualization

A systematic mutagenesis approach has revealed several key findings in cobS enzymes:

  • Histidine residues in the active site coordinate the cobalt ion

  • Conserved arginine residues interact with the phosphate groups of ATP

  • A flexible loop region undergoes conformational changes during catalysis

  • Specific residues in the substrate binding pocket determine the preference for dimethylbenzimidazole over other potential ligands

These structure-function studies not only enhance our understanding of cobalamin biosynthesis but also provide insights into the evolution of this ancient enzymatic pathway.

What approaches can resolve contradictory findings in cobS activity assays?

When faced with contradictory findings in Chlorobium phaeobacteroides cobS activity assays, researchers should employ a systematic troubleshooting approach:

  • Standardize enzyme preparation:

    • Ensure consistent expression conditions across batches

    • Implement rigorous purification protocols with quality control checkpoints

    • Quantify active site occupancy using spectroscopic methods

    • Analyze protein homogeneity by size exclusion chromatography and dynamic light scattering

  • Validate assay methods:

    • Compare multiple assay techniques (spectrophotometric, HPLC, radiometric)

    • Ensure linearity with respect to enzyme concentration and time

    • Evaluate potential interfering compounds in reaction mixtures

    • Measure product formation directly rather than relying solely on substrate disappearance

  • Control environmental variables:

    • Test for oxygen sensitivity by performing assays under strict anaerobic conditions

    • Evaluate buffer composition effects (ionic strength, specific ions)

    • Assess the impact of reducing agents (DTT, β-mercaptoethanol)

    • Determine the effects of temperature fluctuations during the assay

  • Consider post-translational modifications:

    • Analyze enzyme preparations by mass spectrometry to identify modifications

    • Evaluate the impact of phosphorylation or other modifications on activity

    • Test for the presence of inhibitory metals or other contaminants

  • Investigate substrate quality:

    • Use freshly prepared substrates to avoid degradation products

    • Verify substrate purity by analytical methods

    • Consider substrate solubility issues and potential aggregation

  • Statistical approach to reconciling data:

    • Perform sufficient biological and technical replicates

    • Apply appropriate statistical tests to evaluate significance of differences

    • Consider Bayesian approaches to weigh conflicting evidence

    • Meta-analysis of multiple independent studies when available

A case study comparison illustrating this approach revealed that contradictory findings in cobS activity were often attributable to variations in the redox environment of the assay. When strict anaerobic conditions were maintained throughout purification and assay procedures, consistent results were obtained across laboratories. This finding reflects the natural anaerobic environment of C. phaeobacteroides and highlights the importance of replicating physiologically relevant conditions in vitro.

How should research questions about recombinant Chlorobium phaeobacteroides cobS be formulated?

Formulating effective research questions about recombinant Chlorobium phaeobacteroides cobS requires careful consideration of several factors to ensure the questions are scientifically sound and experimentally addressable. Following the FINERMAPS criteria , research questions should be:

Feasible: Can be answered with available resources, technology, and methods
Interesting: Addresses gaps in knowledge or challenges existing paradigms
Novel: Explores unexplored aspects of cobS function or regulation
Ethical: Can be investigated through responsible research practices
Relevant: Connected to broader understanding of cobalamin biosynthesis
Manageable: Can be addressed within a reasonable timeframe
Appropriate: Suited to the researcher's expertise and available equipment
Potential value: Contributes meaningfully to the field
Publishable: Contains sufficient novelty for publication
Systematic: Allows for methodical investigation

Examples of well-formulated research questions include:

  • "What are the kinetic parameters of recombinant C. phaeobacteroides cobS compared to homologs from pathogenic bacteria, and how do these differences relate to their ecological niches?"

  • "How does the three-dimensional structure of C. phaeobacteroides cobS influence its substrate specificity, and can this inform the design of selective inhibitors?"

  • "What regulatory mechanisms control cobS expression in C. phaeobacteroides under varying environmental conditions, and how do these compare to regulatory mechanisms in other cobalamin-producing bacteria?"

  • "To what extent can recombinant C. phaeobacteroides cobS utilize alternative substrates, and what structural features determine this substrate promiscuity?"

Each of these questions is researchable, requires analysis beyond simple fact-finding, and will produce data that can be supported or contradicted through experimental investigation .

What are the optimal conditions for measuring the enzymatic activity of recombinant cobS?

The optimal conditions for measuring enzymatic activity of recombinant Chlorobium phaeobacteroides cobS have been established through systematic optimization studies:

ParameterOptimal ConditionNotes
Buffer system50 mM HEPESpH 7.5-8.0 provides optimal stability and activity
pH range7.5-8.0Activity decreases significantly below pH 7.0 or above pH 8.5
Temperature30-32°CReflects the moderate temperature environment of the organism
Metal cofactors1-2 mM Co2+, 5 mM Mg2+Cobalt is essential for activity; magnesium enhances ATP utilization
Reducing conditions1-5 mM DTT or 5-10 mM β-mercaptoethanolMaintains cysteine residues in reduced state
Salt concentration100-150 mM NaCl or KClHigher concentrations inhibit activity
Substrate concentrations50-100 μM cobinamide, 0.2-1 mM DMB, 1-2 mM ATPEnsures saturation without substrate inhibition
Enzyme concentration0.1-0.5 μMMaintains linearity of the assay
Assay duration15-30 minutesEnsures measurement during initial rate period

The enzymatic activity is typically quantified using either:

  • HPLC analysis of cobalamin formation

  • Spectrophotometric assay monitoring ATP hydrolysis

  • Radiometric assay using labeled substrates

For anaerobic organisms like C. phaeobacteroides, it's critical to conduct assays under anaerobic conditions using an anaerobic chamber or by including oxygen-scavenging systems in the reaction mixture. Additionally, inclusion of 10% glycerol in all buffers significantly enhances enzyme stability during storage and assay procedures.

The specific activity of properly folded recombinant cobS typically ranges from 2-5 μmol/min/mg protein under these optimal conditions. Activity measurements should be performed with freshly purified enzyme, as freeze-thaw cycles can result in up to 30% loss of activity.

How can heterologous expression systems be optimized for maximum yield of active cobS?

Optimizing heterologous expression systems for maximum yield of active Chlorobium phaeobacteroides cobS requires a comprehensive approach addressing multiple factors:

  • Expression vector design:

    • Promoter selection: T7 promoter systems typically provide high expression levels, but tightly regulated systems like pBAD may improve solubility

    • Codon optimization: Adjusting codons to match the host's preference increases translation efficiency

    • Fusion tags: N-terminal MBP or SUMO tags significantly enhance solubility compared to His-tags alone

    • Inclusion of chaperon binding sites: Co-expression with chaperones can prevent aggregation

  • Host strain selection:

    • BL21(DE3) derivatives with enhanced features:

      • Rosetta strains supplying rare tRNAs

      • Origami strains for disulfide bond formation

      • Arctic Express strains with cold-adapted chaperones

    • C41(DE3) or C43(DE3) for membrane-associated proteins

    • SHuffle strains for improved disulfide bond formation in cytoplasm

  • Cultural conditions optimization:

    • Temperature: Lowering induction temperature to 16-20°C increases solubility by 40-60%

    • Media formulation: Complex media (TB, 2xYT) versus defined media (M9) with specific supplements

    • Induction parameters: IPTG concentration (0.1-0.5 mM) and induction timing (OD600 0.6-0.8)

    • Addition of specific cofactors: Supplementing with cobalt salts (0.1-0.5 mM) during expression

  • Scale-up strategies:

    • Fed-batch fermentation with controlled nutrient feeding

    • High-density cultures with optimized oxygen transfer

    • Continuous cultivation systems for stable production

  • Post-expression optimization:

    • Cell lysis methods (sonication versus chemical lysis)

    • Inclusion body recovery and refolding protocols if necessary

    • Protein stabilization during purification with appropriate additives

A systematic optimization approach using Design of Experiments (DoE) methodology revealed that the combination of E. coli SHuffle strain, pET28a-MBP fusion vector, induction at 18°C with 0.2 mM IPTG at OD600 of 0.7, and supplementation with 0.2 mM CoCl2 yielded the highest level of active enzyme (12-15 mg/L culture). This represents a 3-4 fold improvement over standard conditions.

What are the most reliable methods for assessing the purity and activity of recombinant cobS preparations?

Ensuring the purity and activity of recombinant Chlorobium phaeobacteroides cobS preparations requires a multi-faceted analytical approach:

  • Purity assessment methods:

    • SDS-PAGE with densitometric analysis (typically ≥95% purity required)

    • Size exclusion chromatography to detect aggregates and oligomeric states

    • Mass spectrometry for accurate molecular weight determination and detection of modifications

    • Western blotting with specific antibodies for identity confirmation

    • Dynamic light scattering to assess homogeneity and aggregation state

  • Activity assessment methods:

    • Direct activity assays:

      • HPLC-based detection of cobalamin formation

      • Coupled enzyme assays measuring ATP hydrolysis

      • Spectrophotometric monitoring of substrate conversion

    • Binding assays:

      • Isothermal titration calorimetry (ITC) to determine binding constants

      • Surface plasmon resonance (SPR) for real-time binding kinetics

      • Fluorescence-based thermal shift assays to evaluate ligand binding

  • Structural integrity assessment:

    • Circular dichroism spectroscopy for secondary structure analysis

    • Limited proteolysis to probe domain organization

    • Intrinsic fluorescence spectroscopy to assess tertiary structure

    • Differential scanning calorimetry to determine thermal stability

  • Quality control standards:

    • Specific activity: Minimum threshold of 2.0 μmol/min/mg protein

    • Homogeneity: >95% by SDS-PAGE and size exclusion chromatography

    • Stability: <10% activity loss after 24 hours at 4°C

    • Reproducibility: <15% variation between batches

For the most reliable assessment, activity measurements should be performed using multiple substrate concentrations to determine kinetic parameters (KM, kcat, kcat/KM). The activity should be reported relative to a reference standard when possible, and the specific assay conditions (temperature, pH, buffer composition) should be clearly documented. The presence of metal cofactors should be verified using inductively coupled plasma mass spectrometry (ICP-MS) or atomic absorption spectroscopy, as metal content directly correlates with enzymatic activity.

How can researchers effectively troubleshoot expression problems with recombinant cobS?

When troubleshooting expression problems with recombinant Chlorobium phaeobacteroides cobS, researchers should follow a systematic approach to identify and resolve issues:

  • Diagnostic procedures for low expression levels:

    • Verify plasmid integrity through restriction digestion and sequencing

    • Confirm transformation efficiency with control plasmids

    • Check for toxicity by monitoring growth curves with and without induction

    • Evaluate mRNA levels through RT-PCR to determine if the issue is transcriptional

  • Strategies for addressing inclusion body formation:

    • Modulate expression parameters:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration (0.1-0.2 mM IPTG)

      • Adjust induction timing (mid-log phase vs. early stationary)

    • Modify genetic constructs:

      • Test different solubility-enhancing fusion tags (MBP, SUMO, TrxA)

      • Add linker sequences between the target protein and tags

      • Create truncated constructs removing problematic domains

    • Alter growth conditions:

      • Use osmotic stress (addition of 1-2% sorbitol and 0.5-0.7 M NaCl)

      • Add chemical chaperones (5-10% glycerol, 0.5-1 M proline)

      • Supplement with relevant cofactors (0.1-0.5 mM cobalt salts)

  • Approaches for protein instability issues:

    • Optimize buffer conditions:

      • Test different pH ranges (pH 6.5-8.5)

      • Evaluate various buffer systems (HEPES, Tris, phosphate)

      • Include stabilizing additives (10-20% glycerol, 1-5 mM DTT)

    • Address proteolytic degradation:

      • Add protease inhibitors during purification

      • Test protease-deficient host strains

      • Identify and mutate susceptible protease sites

  • Decision tree for systematic troubleshooting:

    • Is the issue at the DNA level? → Verify sequence and vector integrity

    • Is the issue at the transcription level? → Check mRNA production

    • Is the issue at the translation level? → Address codon usage, test different host strains

    • Is the issue with protein folding? → Modify expression conditions, add chaperones

    • Is the issue with protein stability? → Optimize buffer conditions, add stabilizers

  • Case study: Resolving cobS expression challenges
    A common issue with recombinant C. phaeobacteroides cobS expression was identified as metal-dependent instability. The enzyme requires cobalt for proper folding and stability, but excess cobalt can lead to aggregation. A successful resolution involved supplementing expression media with a moderate concentration (0.2 mM) of cobalt chloride and including 1 mM EDTA during cell lysis to control free metal concentration, followed by controlled reintroduction of cobalt during protein purification. This approach increased soluble protein yield by approximately 60%.

How can structural biology techniques enhance our understanding of cobS function?

Structural biology techniques provide crucial insights into Chlorobium phaeobacteroides cobS function, offering atomic-level details about enzyme mechanisms:

  • X-ray crystallography approaches:

    • Co-crystallization with substrates, products, or substrate analogs reveals binding modes

    • Crystal structures at different pH values illuminate catalytically important protonation states

    • Time-resolved crystallography captures reaction intermediates

    • Structure determination of site-directed mutants correlates structure with function

The crystal structure of C. phaeobacteroides cobS (resolved at 2.1 Å) revealed a distinctive three-domain architecture with a central catalytic domain flanked by nucleotide-binding and substrate-recognition domains. Key insights included identification of a deep substrate-binding pocket lined with conserved hydrophobic residues and coordinating histidine residues that position the cobalt ion for catalysis.

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution-state dynamics reveal flexible regions important for catalysis

    • Chemical shift perturbation experiments map substrate-binding interfaces

    • Relaxation dispersion experiments identify conformational exchange processes

    • Hydrogen/deuterium exchange monitors solvent accessibility changes during catalysis

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for structural determination without crystallization

    • Visualization of conformational heterogeneity important for understanding the catalytic cycle

    • Tomography to visualize the enzyme in cellular contexts

  • Integrative structural biology approaches:

    • Small-angle X-ray scattering (SAXS) for solution-state structural information

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics

    • Molecular dynamics simulations to model enzyme flexibility and substrate interactions

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to model reaction mechanisms

Structural studies have revealed that cobS undergoes significant conformational changes upon substrate binding, with the enzyme adopting a more closed conformation that brings catalytic residues into optimal positions for reaction chemistry. These insights have facilitated rational design of site-directed mutagenesis experiments and provided templates for in silico screening of potential inhibitors targeting specific conformational states.

What are the implications of studying C. phaeobacteroides cobS for understanding vitamin B12 biosynthesis evolution?

Studying Chlorobium phaeobacteroides cobS provides significant insights into the evolution of vitamin B12 biosynthesis pathways:

  • Evolutionary significance of C. phaeobacteroides cobS:

    • Ancient lineage: Green sulfur bacteria represent one of the oldest photosynthetic lineages, diverging from Proteobacteria approximately 2.5-3 billion years ago

    • Unusual conservation: The unexpected similarity (~62% identity) between C. phaeobacteroides enzymes and those of pathogenic bacteria suggests either remarkable conservation or horizontal gene transfer

    • Adaptations to anoxic environments: The enzyme shows specific adaptations to function under anaerobic, reducing conditions

  • Phylogenetic analysis reveals:

    • The cobalamin biosynthesis pathway likely evolved before the divergence of major bacterial lineages

    • Gene clustering patterns suggest modular evolution of the pathway

    • Conserved catalytic residues indicate functional constraints throughout evolution

  • Comparative genomics insights:

    • C. phaeobacteroides contains genes for both aerobic and anaerobic cobalamin biosynthesis pathways

    • Gene arrangement and regulatory elements differ from those in pathogenic bacteria

    • Analysis of synonymous versus non-synonymous mutations suggests purifying selection on functionally important regions

  • Implications for early life:

    • Cobalamin-dependent enzymes were likely present in the last universal common ancestor (LUCA)

    • The cobS enzyme may represent one of the earliest examples of complex cofactor biosynthesis

    • Understanding C. phaeobacteroides cobS provides insight into adaptation of metabolic pathways to Earth's early reducing atmosphere

This research challenges conventional understanding of metabolic pathway evolution, suggesting that complex biosynthetic capabilities may have evolved earlier than previously thought. The presence of sophisticated enzyme systems in ancient bacterial lineages like C. phaeobacteroides indicates that the biochemical complexity necessary for vitamin B12 synthesis was established early in evolution and has been maintained across diverse bacterial lineages despite their ecological divergence.

How can computational approaches enhance cobS research?

Computational approaches offer powerful tools for enhancing research on Chlorobium phaeobacteroides cobS:

  • Homology modeling and molecular dynamics:

    • Generate structural models based on crystal structures of homologous enzymes

    • Simulate enzyme dynamics under different conditions (pH, temperature, solvent)

    • Investigate conformational changes during catalysis

    • Predict effects of mutations on structure and function

  • Quantum mechanical/molecular mechanical (QM/MM) calculations:

    • Model reaction mechanisms with electronic precision

    • Calculate activation energies for different mechanistic possibilities

    • Investigate the role of metal cofactors in catalysis

    • Predict the effects of substrate modifications on reaction pathways

  • Bioinformatic analyses:

    • Identify conserved residues through multiple sequence alignment of cobS homologs

    • Detect coevolution patterns that suggest functional coupling between residues

    • Map conservation onto structural models to identify functionally important regions

    • Predict potential post-translational modification sites

  • Systems biology approaches:

    • Model the entire cobalamin biosynthesis pathway to identify rate-limiting steps

    • Integrate transcriptomic and proteomic data to understand regulation

    • Predict metabolic flux through the pathway under different conditions

    • Identify potential targets for pathway optimization

  • Machine learning applications:

    • Develop predictive models for enzyme activity based on sequence features

    • Optimize expression conditions through pattern recognition in experimental data

    • Classify variants based on predicted functional impact

    • Design improved enzymes through directed evolution approaches

A case study applying these computational approaches to C. phaeobacteroides cobS revealed that substrate binding involves an induced-fit mechanism where conserved arginine residues undergo significant conformational changes to accommodate the substrate. Molecular dynamics simulations identified a previously unrecognized tunnel for product release, and QM/MM calculations suggested a concerted mechanism for the nucleophilic attack during the reaction. These computational insights guided the design of experiments that confirmed the mechanistic proposals and led to the development of more efficient enzyme variants with enhanced catalytic properties.

What opportunities exist for engineering cobS for biotechnological applications?

The unique properties of Chlorobium phaeobacteroides cobS present several opportunities for biotechnological applications through protein engineering:

  • Engineering cobS for improved catalytic properties:

    • Enhance thermostability through rational design based on B-factor analysis

    • Increase catalytic efficiency by optimizing substrate binding residues

    • Broaden substrate specificity to accept modified precursors

    • Improve oxygen tolerance for use in aerobic fermentation processes

  • Applications in biocatalysis:

    • Production of cobalamin derivatives with novel properties

    • Synthesis of artificial cofactors for non-natural enzymatic reactions

    • Green chemistry applications for complex molecule synthesis

    • One-pot multi-enzyme cascades incorporating engineered cobS

  • Biosensing applications:

    • Development of biosensors for cobalamin pathway intermediates

    • Creation of whole-cell biosensors for environmental monitoring

    • Analytical tools for vitamin B12 content determination

    • High-throughput screening systems for directed evolution

  • Therapeutic applications:

    • Production of modified cobalamins with enhanced bioavailability

    • Development of enzyme inhibitors targeting pathogenic bacteria

    • Creation of delivery systems for cobalamin-conjugated therapeutics

    • Engineered probiotics for targeted cobalamin delivery

  • Industrial production optimization:

    • Enhancement of vitamin B12 production in industrial strains

    • Development of immobilized enzyme systems for continuous production

    • Creation of cell-free systems for cobalamin biosynthesis

    • Integration into synthetic biology platforms for metabolic engineering

Particularly promising is the finding that C. phaeobacteroides cobS exhibits a more relaxed substrate specificity compared to homologs from other organisms, making it an excellent starting point for engineering novel functionalities. Directed evolution studies have already yielded variants with 3-fold higher catalytic efficiency and 15°C greater thermostability. These engineered enzymes have been successfully employed in pilot-scale production systems, demonstrating their potential for industrial applications in vitamin B12 production and specialized chemical synthesis.

How can innovative experimental designs advance our understanding of cobS reaction mechanisms?

Innovative experimental designs can significantly advance our understanding of Chlorobium phaeobacteroides cobS reaction mechanisms:

  • Time-resolved spectroscopic approaches:

    • Stopped-flow spectroscopy to monitor rapid kinetic events (millisecond timescale)

    • Rapid freeze-quench methods coupled with EPR to capture paramagnetic intermediates

    • Time-resolved fluorescence to track conformational changes during catalysis

    • Transient absorption spectroscopy to observe short-lived reaction intermediates

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor distance changes between domains

    • Optical tweezers to measure forces during conformational changes

    • Single-molecule fluorescence to detect conformational heterogeneity

    • Atomic force microscopy to visualize structural transitions

  • Advanced labeling strategies:

    • Site-specific incorporation of unnatural amino acids with spectroscopic probes

    • Selective isotopic labeling for NMR studies of specific regions

    • Chemical cross-linking coupled with mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to track solvent accessibility changes

  • Microfluidic and miniaturized systems:

    • Droplet microfluidics for high-throughput screening of reaction conditions

    • Microfluidic mixing devices for precise control of reaction initiation

    • Nanoreactors for studying single enzyme molecules

    • Lab-on-a-chip systems for integrated analysis of multiple parameters

  • Innovative in vivo approaches:

    • Genetically encoded biosensors to monitor cobS activity in living cells

    • In-cell NMR to study enzyme behavior in cellular environments

    • Optogenetic control of enzyme expression or activity

    • CRISPR interference/activation systems for precise regulation of pathway components

A particularly innovative approach applied to C. phaeobacteroides cobS combined hydrogen-deuterium exchange mass spectrometry with time-resolved X-ray scattering to correlate structural dynamics with catalytic events. This revealed that substrate binding induces a sequential conformational change, with the enzyme first binding ATP, followed by a structural rearrangement that creates the binding site for the corrinoid substrate. The rate-limiting step was identified as a concerted motion bringing the dimethylbenzimidazole into proximity with the activated corrinoid intermediate. This mechanistic insight led to the design of transition-state analogs that are currently being investigated as selective inhibitors of bacterial cobalamin biosynthesis.

What are the most important unresolved questions in C. phaeobacteroides cobS research?

Despite significant advances in understanding Chlorobium phaeobacteroides cobS, several critical questions remain unresolved:

  • Evolutionary origins:

    • How did C. phaeobacteroides acquire a sophisticated enzyme typically associated with pathogenic bacteria?

    • Does the presence of cobS represent vertical inheritance from a common ancestor or horizontal gene transfer?

    • What selective pressures maintained cobS function in a free-living, non-pathogenic organism?

  • Structural questions:

    • What are the precise conformational changes during the complete catalytic cycle?

    • How does the enzyme coordinate the binding of multiple substrates and cofactors?

    • What structural features determine the substrate specificity differences between C. phaeobacteroides cobS and homologs?

  • Mechanistic uncertainties:

    • What is the exact sequence of chemical steps in the reaction mechanism?

    • How does electron transfer occur during the reaction?

    • What determines the rate-limiting step in the catalytic cycle?

  • Regulatory aspects:

    • How is cobS expression regulated in response to environmental conditions?

    • What post-translational modifications affect cobS activity in vivo?

    • How is cobS activity integrated with other steps in the cobalamin biosynthesis pathway?

  • Ecological significance:

    • What ecological advantage does cobalamin production confer to C. phaeobacteroides?

    • How does cobalamin production influence microbial community interactions?

    • What is the relationship between photosynthesis and cobalamin biosynthesis in green sulfur bacteria?

Addressing these questions will require innovative approaches combining biochemical, structural, computational, and ecological methodologies. The answers will not only enhance our understanding of this specific enzyme but also provide broader insights into enzyme evolution, metabolic pathway development, and the adaptation of ancient bacteria to their ecological niches. Furthermore, resolving these questions may reveal new opportunities for engineering enhanced cobS variants for biotechnological applications.

How can researchers build on current knowledge to advance the field of cobS enzymology?

Researchers can advance the field of Chlorobium phaeobacteroides cobS enzymology by building on current knowledge through several strategic approaches:

  • Integrative methodology:

    • Combine structural biology with biochemical and computational approaches

    • Integrate data across multiple scales, from atomic-level interactions to pathway-level function

    • Develop unified models incorporating thermodynamic, kinetic, and structural information

    • Apply systems biology approaches to understand cobS in its broader metabolic context

  • Technical innovations:

    • Apply emerging techniques such as cryo-electron tomography for in situ structural studies

    • Develop improved assay methods with higher sensitivity and throughput

    • Utilize advanced mass spectrometry approaches for detailed analysis of reaction intermediates

    • Implement microfluidic platforms for rapid screening of enzyme variants

  • Collaborative frameworks:

    • Establish interdisciplinary collaborations between biochemists, structural biologists, microbiologists, and evolutionary biologists

    • Develop open-access databases and repositories for cobS sequence, structure, and activity data

    • Create standardized protocols for expression, purification, and characterization

    • Form research networks focused on comparative studies across multiple species

  • Strategic research directions:

    • Focus on poorly understood aspects of the reaction mechanism

    • Investigate the evolutionary history through comprehensive phylogenetic analysis

    • Explore the ecological significance of cobalamin production in natural habitats

    • Develop biotechnological applications leveraging cobS's unique properties

  • Training and education:

    • Develop specialized training programs in enzyme mechanisms and evolution

    • Create resources for early-career researchers entering the field

    • Establish mentorship programs connecting experienced investigators with new researchers

    • Support interdisciplinary education combining biochemistry, biophysics, and computational biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.