Recombinant Chlorobium phaeobacteroides Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
mscL; Cpha266_1262; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain DSM 266)
Target Names
mscL
Target Protein Sequence
MLKEFKDFAVRGNVVDMAVGIIIGAAFTTIINTLVNEVVMPPIGVLLGGVDFSDFYLLLK EGSKAAPYESLAAAKSAGAVTLSYGIFVNACISFLIVTFVMFLSVKGINRLRAKEDAAPD PAVRECPFCCSPVSVKAKRCPMCTSELK
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium phaeobacteroides and why is its mscL protein significant for research?

Chlorobium phaeobacteroides is a photosynthetic green sulfur bacterium that inhabits strictly anaerobic environments, typically found in the anaerobic zones of eutrophic lakes . These bacteria are photolithotrophic oxidizers of sulfur and utilize a noncyclic electron transport chain to reduce NAD+ . The large-conductance mechanosensitive channel (mscL) from C. phaeobacteroides is significant because mechanosensitive channels are among the largest natural pores, with diameters exceeding 25 Å, capable of allowing passage of large organic ions and small proteins . This specific channel represents an evolutionary adaptation in a unique photosynthetic organism, making it valuable for comparative studies of mechanosensitive channels across bacterial phyla.

What expression systems are recommended for producing recombinant C. phaeobacteroides mscL?

For recombinant expression of C. phaeobacteroides mscL, Escherichia coli-based systems are commonly employed, similar to those used for other bacterial membrane proteins . When expressing this protein, consider using expression vectors with tightly controlled promoters (such as T7 or tac) to prevent potential toxicity from overexpression. For optimal yield, BL21(DE3) or C41/C43(DE3) E. coli strains designed for membrane protein expression are recommended. Key parameters to optimize include:

ParameterRecommended Conditions
Induction temperature18-25°C
IPTG concentration0.1-0.5 mM
Expression duration4-16 hours
MediaTB or 2XYT supplemented with glycerol

For purification, detergent solubilization using n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) followed by affinity chromatography using His-tag or other fusion tags provides good yields while maintaining protein functionality .

How can the functionality of recombinant C. phaeobacteroides mscL be verified?

Functionality of recombinant C. phaeobacteroides mscL can be verified through several complementary approaches:

  • Patch-clamp electrophysiology: After reconstitution into liposomes or expression in mammalian cells, patch-clamp analysis can directly measure channel conductance and gating properties in response to membrane tension .

  • Fluorescent dye release assays: By loading fluorescent dyes into liposomes containing the reconstituted channel, researchers can measure dye release upon channel activation using osmotic shock or membrane-stretching agents.

  • Controlled molecular delivery: As demonstrated with other MscL proteins, functional verification can include testing the ability to deliver membrane-impermeable molecules (such as fluorescent markers or bioactive compounds like phalloidin) into cells expressing the channel .

  • Membrane tension response assays: Since MscL channels respond to increased membrane tension, monitoring cell viability under hypoosmotic shock conditions in cells expressing the recombinant channel versus controls can provide functional evidence.

How does the C. phaeobacteroides mscL compare functionally to mechanosensitive channels from other bacterial species?

The C. phaeobacteroides mscL represents an interesting research target due to its origin in a photosynthetic green sulfur bacterium that evolved in a distinctly different ecological niche compared to extensively studied mechanosensitive channels from Escherichia coli or Mycobacterium tuberculosis.

Comparative functional analysis reveals several important distinctions:

PropertyC. phaeobacteroides mscLE. coli MscLNotes
Gating thresholdNot fully characterized~10-12 mN/mMay differ due to membrane composition adaptations
ConductanceSimilar to other MscL proteins~3 nSLarge conductance is consistent across MscL family
Environmental adaptationEvolved for anaerobic, low-light conditionsAdapted for fluctuating osmotic conditionsPotentially different sensitivity profiles
Phylogenetic relationshipGreen sulfur bacteria lineageProteobacteria lineageDiverged approximately 2.5-3 billion years ago

The differences in evolutionary history between C. phaeobacteroides and proteobacteria like E. coli (diverging 2.5-3 billion years ago) suggest potential functional adaptations specific to anaerobic photosynthetic lifestyles. These adaptations might include modified gating mechanisms optimized for the unique membrane composition of green sulfur bacteria, which contain specialized photosynthetic structures.

What approaches can be used to study the in vivo role of mscL in C. phaeobacteroides ecological adaptation?

Studying the in vivo role of mscL in C. phaeobacteroides ecological adaptation requires specialized approaches due to the strict anaerobic nature of this organism and its unique photosynthetic lifestyle. Recommended methodological approaches include:

  • Genetic manipulation strategies:

    • Targeted gene disruption using homologous recombination techniques similar to those established for C. tepidum

    • CRISPR-Cas9 system adapted for anaerobic green sulfur bacteria

    • Complementation studies with mutated mscL variants

  • Environmental stress response assays:

    • Measuring survival rates under various osmotic stress conditions

    • Examining light intensity adaptation with functional versus mutated mscL

    • Testing temperature stress responses in relation to membrane fluidity and channel gating

  • Microscopy-based techniques:

    • Fluorescent protein tagging to track localization under varying environmental conditions

    • Super-resolution microscopy to determine if mscL co-localizes with photosynthetic apparatus

    • Time-lapse imaging during osmotic challenges

  • Transcriptomic and proteomic approaches:

    • RNA-seq analysis comparing expression under various ecological stressors

    • Differential protein expression profiling

    • Protein-protein interaction studies to identify partners specific to C. phaeobacteroides

These approaches should be conducted under strict anaerobic conditions to maintain physiological relevance for this obligate anaerobe .

How can recombinant C. phaeobacteroides mscL be utilized for controlled molecular delivery into mammalian cells?

The large pore size of MscL channels (>25 Å) makes them excellent candidates for controlled molecular delivery systems . To utilize recombinant C. phaeobacteroides mscL for this purpose:

  • Engineering expression constructs:

    • Design mammalian expression vectors with tissue-specific or inducible promoters

    • Create fusion constructs with fluorescent tags for localization monitoring

    • Develop charge-sensitive mutants that activate at specific membrane potentials

  • Activation mechanisms optimization:

    • Implement established methods of charge-induced activation

    • Test light-sensitive modifications for optogenetic control

    • Develop chemical triggers specific to the C. phaeobacteroides variant

  • Delivery protocol development:

    • Determine size limitations using fluorescently labeled model cargoes of increasing molecular weight

    • Optimize protocols for different cargo types (peptides, small proteins, nucleic acids)

    • Establish quantifiable parameters for delivery efficiency

  • Specialized applications:

    • Test delivery of cell-impermeable markers like phalloidin for cytoskeletal visualization

    • Evaluate therapeutic molecule delivery potential

    • Assess capacity for delivering gene editing components

The implementation requires careful characterization of any functional differences between C. phaeobacteroides mscL and previously studied mechanosensitive channels to ensure optimal performance in mammalian expression systems.

What structural modifications to C. phaeobacteroides mscL can enhance its utility for biotechnological applications?

Structural modifications to enhance C. phaeobacteroides mscL utility can be approached through rational design based on sequence-function relationships. Key modification strategies include:

  • Gating threshold adjustments:

    • Targeted mutations in transmembrane domains to alter the force required for channel opening

    • Introduction of charged residues at strategic positions to create channels that respond to specific stimuli

    • Development of pH-sensitive variants by modifying residues that undergo protonation changes

  • Pore size engineering:

    • Modifications to alter the channel diameter for selecting specific molecule sizes

    • Creation of asymmetric pores for directional transport

    • Introduction of constriction sites for enhanced selectivity

  • Stimulus-responsive modifications:

    • Engineering light-sensitive domains for optogenetic control

    • Adding ligand-binding domains for chemically-triggered gating

    • Creating temperature-sensitive variants through stability modifications

  • Stability enhancements:

    • Disulfide bridge engineering to improve structural integrity in non-native environments

    • Surface residue modifications to enhance solubility

    • Core packing optimizations to improve thermal stability

The unique evolutionary background of C. phaeobacteroides mscL, coming from a green sulfur bacterium with specialized photosynthetic machinery , may provide novel structural features that could be advantageous for certain biotechnological applications compared to more commonly studied mechanosensitive channels.

How does the membrane environment affect the function of recombinant C. phaeobacteroides mscL?

The membrane environment critically influences mechanosensitive channel function. For C. phaeobacteroides mscL, this relationship is particularly relevant given the specialized membrane architecture of this photosynthetic bacterium:

  • Lipid composition effects:

    • The native membrane of C. phaeobacteroides contains unique glycolipids, particularly monogalactosyldiglycerol , which likely influences channel gating

    • When reconstituted in different lipid environments, channel properties may significantly change:

Membrane CompositionExpected Effect on mscL Function
High PE contentLikely decreases gating threshold
High cholesterolMay increase gating threshold
Bacterial vs. mammalian lipidsPotentially alters conductance properties
Lipid raft associationMay affect clustering and cooperative gating
  • Interaction with photosynthetic apparatus:

    • C. phaeobacteroides contains specialized chlorosomes that may interact with membrane proteins

    • Potential co-localization with chlorosome attachment sites could influence channel distribution and function

    • The presence of carotenoids in the membrane, which are abundant in C. phaeobacteroides , might affect membrane properties and thus channel mechanics

  • Methodological considerations:

    • When studying recombinant channel function, membrane mimetics should be carefully selected

    • For maximal native-like function, lipid compositions resembling green sulfur bacterial membranes should be considered

    • Reconstitution protocols may need optimization compared to standard approaches used for E. coli-derived channels

Understanding these membrane interactions is crucial for accurate functional characterization and for developing effective reconstitution protocols for biotechnological applications.

What are the key methodological challenges in structural studies of C. phaeobacteroides mscL?

Structural studies of C. phaeobacteroides mscL face several significant methodological challenges that researchers should address:

  • Protein expression and purification barriers:

    • Obtaining sufficient quantities of homogeneous protein for structural studies

    • Preventing aggregation during extraction from membranes

    • Maintaining structural integrity throughout purification

  • Membrane protein crystallization difficulties:

    • Identifying appropriate detergents that maintain native conformation

    • Developing crystallization conditions that accommodate the hydrophobic surfaces

    • Generating well-diffracting crystals for X-ray crystallography

  • Cryo-EM specific challenges:

    • Small size of the protein (133 amino acids) makes it challenging for single-particle analysis

    • Detergent micelles can interfere with image contrast

    • Capturing different conformational states during the gating process

  • NMR spectroscopy considerations:

    • Size limitations for solution NMR approaches

    • Need for isotopic labeling in an expression system that maintains functionality

    • Reconstituting the protein in membrane mimetics suitable for NMR studies

  • Computational modeling complexities:

    • Limited homology to structurally characterized mechanosensitive channels

    • Accurately representing the membrane environment and tension forces

    • Modeling conformational changes during gating

A recommended multi-faceted approach would include:

  • Integration of complementary structural methods (X-ray, cryo-EM, SAXS, EPR spectroscopy)

  • Development of nanodiscs or other membrane mimetics optimized for green sulfur bacterial proteins

  • Leveraging molecular dynamics simulations to bridge experimental data gaps

How can the evolutionary relationship between C. phaeobacteroides mscL and other mechanosensitive channels inform functional studies?

The evolutionary history of C. phaeobacteroides mscL provides valuable context for functional studies, particularly given that green sulfur bacteria and proteobacteria lineages diverged approximately 2.5-3 billion years ago :

  • Phylogenetic analysis insights:

    • Comparative sequence analysis between mscL from C. phaeobacteroides and other bacterial phyla can identify conserved functional domains versus lineage-specific adaptations

    • Analysis of selection pressures on different protein regions can highlight functionally critical residues

    • Ancestral sequence reconstruction can inform about the evolution of mechanosensitivity mechanisms

  • Structure-function relationship implications:

    • Conserved residues across distantly related bacteria likely represent core functional elements

    • Divergent regions may reflect adaptations to specific ecological niches and membrane compositions

    • The potential for horizontal gene transfer should be assessed, particularly given the unexpected presence of genes like chondroitin synthase in C. phaeobacteroides

  • Methodological approaches:

    • Multiple sequence alignments incorporating diverse bacterial mechanosensitive channels

    • Construction of chimeric channels combining domains from evolutionary distant species

    • Site-directed mutagenesis targeting both conserved and divergent residues

    • Complementation studies in heterologous systems

  • Expected research insights:

    • Identification of universal versus specialized mechanosensing mechanisms

    • Understanding how environmental adaptations shape channel properties

    • Potential discovery of novel gating mechanisms specific to photosynthetic bacteria

This evolutionary perspective is particularly valuable considering that C. phaeobacteroides inhabits a specialized ecological niche as an anaerobic phototroph , potentially driving unique adaptations in its mechanosensitive channels.

What are the recommended protocols for functional reconstitution of C. phaeobacteroides mscL in artificial membrane systems?

For optimal functional reconstitution of C. phaeobacteroides mscL in artificial membrane systems, consider this detailed protocol framework:

  • Protein preparation:

    • Extract purified protein in a stabilizing detergent (recommended: DDM at 0.05%)

    • Maintain reducing conditions with 1-5 mM DTT to prevent disulfide formation

    • Ensure protein concentration between 1-2 mg/ml for optimal reconstitution

  • Lipid preparation:

    • For biomimetic conditions, use a mixture resembling green sulfur bacterial membranes:

      • 70% POPE (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine)

      • 20% POPG (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol)

      • 10% monogalactosyldiacylglycerol (to mimic native chlorosome lipids)

    • Prepare small unilamellar vesicles by extrusion through 100 nm polycarbonate filters

  • Reconstitution procedure:

    • Mix protein and lipids at lipid-to-protein ratios between 100:1 and 400:1

    • Remove detergent via:

      • Bio-Beads SM-2 adsorption (preferred method)

      • Dialysis against detergent-free buffer (alternative approach)

    • Incubate the mixture at 4°C with gentle agitation for 12-24 hours

  • Verification methods:

    • Liposome size and homogeneity assessment via dynamic light scattering

    • Protein incorporation verification through freeze-fracture electron microscopy

    • Functional assessment via:

      • Patch-clamp electrophysiology of giant unilamellar vesicles

      • Fluorescent dye release assays using calcein-loaded proteoliposomes

  • Critical parameters and troubleshooting:

ParameterOptimal RangeTroubleshooting if Outside Range
pH7.0-7.5Adjust buffer composition
Ionic strength150-200 mM NaClDecrease for higher activity, increase for stability
Temperature4°C for reconstitution, 20-25°C for assaysLower temperature if aggregation occurs
Lipid oxidationMinimize exposure to oxygenUse freshly prepared lipids, work under nitrogen

This protocol framework should be optimized based on the specific experimental requirements and adjusted according to the functional assays planned for the reconstituted channels.

What are the most promising future research directions for C. phaeobacteroides mscL?

The study of C. phaeobacteroides mscL offers several compelling future research directions with potential for significant scientific impact:

  • Comparative mechanobiology:

    • Exploring how mechanosensitive channel properties evolved differently in photosynthetic bacteria compared to heterotrophs

    • Investigating potential interactions between mechanosensing and photosynthetic machinery

    • Understanding membrane adaptation mechanisms in extremophilic environments

  • Biotechnological applications:

    • Developing specialized molecular delivery systems exploiting unique properties of this channel

    • Creating biosensors based on the gating properties specific to this protein

    • Engineering variants with novel gating mechanisms for synthetic biology applications

  • Structural biology frontiers:

    • Resolving the high-resolution structure in multiple conformational states

    • Mapping the energy landscape of channel gating

    • Investigating protein-lipid interactions specific to photosynthetic bacterial membranes

  • Integration with other bacterial systems:

    • Exploring potential functional relationships with other unique C. phaeobacteroides proteins, such as the chondroitin synthase that shows unexpected evolutionary conservation

    • Investigating whether mechanosensing plays a role in regulation of specialized structures like chlorosomes

  • Ecological significance studies:

    • Determining the role of mechanosensitive channels in adaptation to the specific ecological niche of C. phaeobacteroides

    • Investigating how mechanosensing contributes to survival in anoxic, sulfide-rich environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.