Recombinant Chlorobium phaeobacteroides Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role of lspA

lspA is a type II signal peptidase responsible for cleaving the N-terminal signal peptide of prolipoproteins, enabling the attachment of lipid anchors to the mature lipoprotein. This enzymatic activity is conserved across Gram-negative and certain Gram-positive bacteria, including Chlorobium phaeobacteroides.

Key Functions:

  • Lipoprotein Maturation: lspA cleaves the "lipobox" sequence (LVI/LVIG-C*, where C denotes a diacylglyceryl-modified cysteine) to release the mature lipoprotein.

  • Membrane Stability: Lipoproteins are critical for bacterial outer membrane (OM) structure and function, particularly in pathogens.

  • Drug Target Potential: lspA inhibitors, such as globomycin, block catalytic activity by binding to the active site, making it a candidate for antimicrobial development .

Role in Bacterial Pathogenicity

While lspA is non-essential in some Gram-positive bacteria (e.g., Staphylococcus aureus), its deletion in Acinetobacter baumannii leads to sensitivity to serum and reduced virulence . In Chlorobium phaeobacteroides, lspA’s role in photosynthetic membrane stability remains under investigation.

Drug Development and Inhibition

lspA is a target for species-specific antibiotics. Inhibitors like globomycin and myxovirescin bind to the catalytic pocket, blocking substrate access. Structural studies of lspA orthologs (e.g., Pseudomonas aeruginosa) have guided inhibitor design, though Chlorobium phaeobacteroides lspA’s sensitivity to these compounds remains unstudied .

Recombinant Production and Purification

Recombinant lspA is expressed in heterologous systems (e.g., E. coli) with affinity tags for purification. The enzyme is typically stored in Tris-based buffers with glycerol to maintain activity.

Comparative Analysis of lspA Orthologs

The following table highlights differences in lspA function and inhibitor sensitivity across bacterial species:

SpecieslspA Essential?Sensitivity to GlobomycinKey Role
Pseudomonas aeruginosaYesHighOM lipoprotein processing
Staphylococcus aureusNoModerateVirulence in blood infections
Chlorobium phaeobacteroidesUnknownNot reportedPhotosynthetic membrane stability

Challenges and Future Directions

  • Limited Data: Most lspA studies focus on pathogens like Pseudomonas and Staphylococcus. Research on Chlorobium phaeobacteroides lspA is sparse.

  • Therapeutic Potential: Designing lspA inhibitors specific to Chlorobium could reduce off-target effects in non-pathogenic species.

  • Structural Studies: High-resolution crystallography of Chlorobium lspA would elucidate species-specific binding pockets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
lspA; Cpha266_0707; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain DSM 266)
Target Names
lspA
Target Protein Sequence
MNWFFTLASIVIVLDQLTKKIAVMILKEKESVTLIPDWLKFTYAENNGIAFGMEFAPKEV MILLVGTISLLIALYVFRSKNRTTRFILPFALVFGGGVGNMIDRITGGKVIDFIHIDLYN GMIMGTWVSLWPIFNIADSAITIGACLLILFHSTIFPDQSVQKNTDVH
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (lspA) and what is its function in bacterial systems?

Lipoprotein Signal Peptidase (lspA), also known as Signal Peptidase II or SPase II, is an aspartyl protease that plays a critical role in bacterial lipoprotein processing. It specifically cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway . This enzyme is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, making it a promising target for antibiotic development . The mature lspA protein from Chlorobium phaeobacteroides consists of 159 amino acids .

What are the optimal storage conditions for recombinant lspA protein?

For optimal stability, store recombinant lspA at -20°C/-80°C upon receipt . The protein should be aliquoted to prevent repeated freeze-thaw cycles which can degrade protein quality. Working aliquots can be stored at 4°C for up to one week . The protein is typically stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . When storing aliquots long-term, we recommend adding glycerol to a final concentration between 5-50% (with 50% being standard practice) before storing at -20°C/-80°C .

What is the recommended reconstitution protocol for lyophilized lspA?

For reconstitution of lyophilized lspA:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot to prevent repeated freeze-thaw cycles

This protocol ensures maximum retention of enzymatic activity and structural integrity of the recombinant protein.

How is the purity of recombinant lspA typically assessed?

The purity of recombinant lspA is primarily determined using SDS-PAGE analysis, with quality control standards typically requiring greater than 90% purity . Complementary techniques often include Western blotting (especially when confirming membrane localization) , mass spectrometry for precise molecular weight determination, and activity assays to confirm functional integrity. When using antibodies for detection, those raised against homologous proteins (such as Chromatium vinosum FCSD) have been successfully employed in cross-species detection .

What are the key structural features of lspA that contribute to its function?

LspA contains several important structural elements:

  • A catalytic dyad essential for proteolytic activity

  • A periplasmic helix (PH) that fluctuates on the nanosecond timescale

  • A β-cradle structure that contributes to substrate binding

  • 14 highly conserved residues surrounding the active site

The periplasmic helix exhibits significant conformational dynamics, sampling unique conformations in different states (apo versus antibiotic-bound) . In the apo (unbound) state, the dominant conformation is closed, effectively occluding the charged active site from the lipid bilayer. When an antibiotic is bound, the periplasmic helix adopts a more open conformation, revealing multiple binding modes .

What methods are most effective for studying the conformational dynamics of lspA?

Research indicates that a hybrid experimental approach combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) spectroscopy provides the most comprehensive insights into lspA conformational dynamics . This methodology revealed:

  • The periplasmic helix fluctuates on the nanosecond timescale

  • In the apo state, the dominant conformation occludes the charged active site from the lipid bilayer

  • With antibiotic bound, multiple binding modes exist with a more open conformation

  • The enzyme demonstrates flexibility and adaptability in its active site

Specifically, continuous wave (CW) EPR and double electron-electron resonance (DEER) EPR techniques are effective for measuring distances between specific sites on the protein, such as between the periplasmic helix and the β-cradle .

How can one design effective molecular dynamics simulations to study lspA?

Based on published research, an effective MD simulation protocol for lspA includes:

  • Initial setup using GROMACS software with appropriate force fields (e.g., Martini 2.2)

  • Assembly and equilibration of a membrane bilayer (e.g., POPG/POPE 1:4 molar ratio) around lspA

  • Application of an elastic network between backbone beads

  • Energy minimization followed by simulation at physiological temperature (310 K) and pressure (1 bar)

  • Conversion of coarse-grained simulations to atomistic descriptions using tools like CG2AT

  • Analysis of conformational states and dynamics

This approach allows researchers to observe the nanosecond timescale dynamics of the periplasmic helix and characterize the different conformational states of the enzyme.

What are the recommended protocols for site-directed spin labeling of lspA for EPR studies?

For effective EPR studies of lspA using site-directed spin labeling:

  • Select strategic labeling sites:

    • On the β-cradle, choose residues at the end of a β-strand with reduced backbone dynamics (e.g., I43) rather than flexible loop sites

    • Avoid highly conserved residues with known evolutionary couplings (e.g., F59 which couples with F136)

    • Select sites that provide optimal distance ranges for DEER measurements

  • Mutate selected residues to cysteines for spin label attachment

  • Consider the impact of labeling on protein folding and function

  • Use both CW EPR (for nanosecond timescale dynamics) and DEER EPR (for distance measurements)

This approach can reveal conformational changes, such as the repositioning of the periplasmic helix observed in the nanosecond time regime .

What is the optimal expression system for producing recombinant Chlorobium phaeobacteroides lspA?

The standard expression system for Chlorobium phaeobacteroides lspA is E. coli, which provides good yields of functional protein . The recombinant construct typically includes an N-terminal His-tag for purification purposes . When designing expression constructs, researchers should consider:

  • Codon optimization for the expression host

  • Signal sequence design for proper membrane targeting

  • Selection of appropriate fusion tags for purification and detection

  • Expression conditions that minimize protein aggregation and maximize functional yield

The full-length protein (amino acids 1-159) can be successfully expressed and purified from this system .

How does the presence of a His-tag affect the structural and functional properties of recombinant lspA?

While the N-terminal His-tag facilitates purification of recombinant lspA, researchers should consider potential effects on:

  • Protein folding and stability

  • Enzymatic activity

  • Membrane insertion and orientation

  • Substrate recognition and binding

For studies requiring native-like behavior, it may be necessary to include a protease cleavage site between the His-tag and the protein sequence. Alternatively, researchers can compare the properties of tagged and untagged versions of the protein to assess any functional differences.

How can researchers leverage lspA conformational dynamics for antibiotic development?

The conformational dynamics of lspA provide several opportunities for antibiotic development:

  • Target the closed conformation of the periplasmic helix in the apo state to prevent substrate access

  • Design compounds that stabilize intermediate conformations, as observed with globomycin binding

  • Exploit the highly conserved active site residues, where resistance mutations would likely compromise enzyme function

Research shows that lspA from different bacterial species (e.g., Pseudomonas aeruginosa and Staphylococcus aureus) has been crystallized with antibiotics like globomycin and myxovirescin . The extensive conservation of active site residues suggests that resistance mutations affecting antibiotic binding would likely also interfere with substrate binding and cleavage .

AntibioticTarget ConformationMechanism of ActionDevelopment Status
GlobomycinIntermediate openStabilizes intermediate conformation inhibiting signal peptide cleavage and substrate bindingNot commercially viable
MyxovirescinSimilar to globomycinBinds to catalytic dyadNot commercially viable
Novel candidatesVariousTarget multiple conformational statesUnder research

What techniques can be used to study the interaction between lspA and its substrates?

Several complementary techniques can be employed to study lspA-substrate interactions:

  • Molecular dynamics simulations to model substrate binding and identify key interaction residues

  • EPR spectroscopy to measure conformational changes upon substrate binding

  • X-ray crystallography or cryo-EM to determine structures of enzyme-substrate complexes

  • Enzyme kinetics to quantify binding affinity and catalytic efficiency

  • Mutagenesis studies to identify critical residues for substrate recognition and processing

Current models suggest that the β-cradle and periplasmic helix "clamp" the substrate in place, with the periplasmic helix undergoing conformational dynamics to allow different lipoprotein substrates to enter the active site .

How does the membrane environment affect lspA activity and what methods can be used to study this relationship?

As a membrane-bound enzyme, lspA function is intimately connected to its lipid environment. Researchers can investigate this relationship using:

  • Reconstitution in various lipid compositions (e.g., POPG/POPE at different ratios)

  • Fluorescence spectroscopy to monitor conformational changes in different membrane environments

  • MD simulations incorporating different membrane compositions

  • Activity assays in various detergent and lipid environments

Studies have shown that LspA is localized to the membrane, which can be confirmed by Western blotting . The membrane environment likely influences the conformational dynamics of the periplasmic helix, affecting substrate access and catalytic activity.

What role does lspA play in bacterial pathogenesis and virulence?

LspA plays critical roles in bacterial pathogenesis:

  • It is essential in Gram-negative bacteria, making it a vital target for antibacterial therapies

  • It is important for virulence in Gram-positive bacteria

  • It processes lipoproteins that may be involved in host-pathogen interactions

  • The enzyme's activity affects membrane integrity and bacterial survival

These roles highlight why lspA is considered an excellent target for the development of antibiotic therapeutics with potentially lower risk of resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.