Recombinant Chlorobium phaeobacteroides NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Cphamn1_1607; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain BS1)
Target Names
nuoA
Target Protein Sequence
MDQTLSDFGTVFVFLLLGIIFVVGGYLTARLLRPSRPNPEKLAIYECGEEAVGSAWVKFN IRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILVIGLVYAWVKGDLDW VRPTPNIPKMPVLEEDESQVVS
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. The enzyme couples this redox reaction to proton translocation, translocating four protons across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what role does it play in bacterial metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is a small membrane-spanning subunit of respiratory chain NADH:quinone oxidoreductase (complex I). Unlike other complex I core protein subunits, the nuoA protein has no known homologues in other enzyme systems . In bacteria like Chlorobium phaeobacteroides, this protein is part of the energy production pathway that couples electron transfer from NADH to ubiquinone with ion pumping, generating an electrochemical gradient essential for energy-consuming cellular processes .

The protein is particularly significant as it represents a component of a respiratory complex exclusive to prokaryotes, making it a potential target for highly selective antibiotics . The nuoA subunit contributes to the membrane domain of complex I and plays a role in the structural integrity and function of the entire complex.

What experimental evidence confirms the transmembrane orientation of nuoA?

Research on the E. coli homologue demonstrates that the C-terminal end of nuoA is localized in the bacterial cytoplasm . This finding contrasts with previous reports for the homologous NQO7 subunit from Paracoccus denitrificans complex I, highlighting species-specific differences in orientation.

The experimental approach used fusion proteins to cytochrome c and to alkaline phosphatase to determine the orientation. These fusion protein studies provide more definitive evidence than computational predictions, which are challenging for nuoA due to its small size and variable charge distribution .

MethodFindingReference
Fusion to cytochrome cC-terminal end in cytoplasm (E. coli)
Fusion to alkaline phosphataseC-terminal end in cytoplasm (E. coli)
Previous studies on P. denitrificansOpposite orientation reported

What expression systems are most effective for producing recombinant Chlorobium phaeobacteroides nuoA?

Based on available research, recombinant Chlorobium phaeobacteroides nuoA has been successfully expressed in E. coli expression systems . When designing an expression system, researchers should consider:

  • Vector selection: Systems with N-terminal His-tag have been successfully employed for purification purposes .

  • Expression conditions: The hydrophobic nature of this membrane protein requires optimization of temperature, inducer concentration, and expression duration.

  • Solubilization methods: As a membrane protein, appropriate detergents are necessary for proper solubilization during purification.

The commercially available recombinant protein is generally produced as a full-length protein (amino acids 1-142) fused to an N-terminal His tag and expressed in E. coli . This system appears to provide sufficient yield and purity for most research applications.

What are the optimal storage and handling conditions for recombinant nuoA?

To maintain structural integrity and function of recombinant nuoA, the following storage and handling parameters are recommended:

  • Storage temperature: Store at -20°C/-80°C upon receipt, with working aliquots kept at 4°C for up to one week .

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been successfully used .

  • Reconstitution: Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Cryoprotectant: Addition of 5-50% glycerol (final concentration) is recommended for long-term storage, with 50% being the standard concentration used in commercial preparations .

  • Avoiding denaturation: Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers verify the proper folding and function of recombinant nuoA?

Verifying proper folding and function of recombinant nuoA is challenging due to its membrane-bound nature. Researchers can employ several complementary approaches:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure elements characteristic of properly folded membrane proteins.

  • Integration into proteoliposomes: Reconstitution into artificial membrane systems followed by functional assays.

  • Co-purification with interaction partners: Assessing binding to other complex I components as an indication of proper folding.

  • Activity assays: While nuoA alone may not show enzymatic activity, its contribution to reconstituted complex I activity can be measured through NADH oxidation assays.

  • Structural analysis: Cryo-EM techniques have been successfully used to analyze complex I with nuoA in place, providing structural verification .

How does nuoA contribute to the electron transfer mechanism in complex I?

The exact contribution of nuoA to electron transfer in complex I is still being investigated, but several aspects have been elucidated:

The structural data from Cryo-EM studies of Na+-NQR has revealed that the organization of electron transfer components is critical for function, with nuoA potentially playing a role in maintaining these relationships .

What is the relationship between nuoA and Na+/H+ pumping in bacterial respiratory chains?

The Na+-pumping NADH-ubiquinone oxidoreductase (Na+-NQR) couples electron transfer from NADH to ubiquinone with Na+-pumping, generating an electrochemical Na+ gradient across the bacterial membrane . While the exact molecular mechanism remains not fully understood:

  • nuoA is positioned within the membrane domain where ion translocation occurs.

  • The C-terminal positioning in the cytoplasm (at least in E. coli) may play a role in ion channel formation or regulation .

  • The inhibitor binding studies with korormicin A and aurachin D-42 suggest that structural changes in complex I, which may involve nuoA, are important for ion pumping function .

This ion pumping process is crucial for energy-consuming cellular processes such as flagellar motor rotation, ion homeostasis, and nutrient uptake in bacteria like Vibrio cholerae, Vibrio alginolyticus, and Haemophilus influenzae .

How does nuoA in Chlorobium phaeobacteroides compare to homologous proteins in photosynthetic and non-photosynthetic bacteria?

Chlorobium phaeobacteroides belongs to the phylum Chlorobi, which contains green sulfur bacteria capable of photoferrotrophy (iron oxidation using light energy) . Comparative analysis reveals:

AttributeChlorobium phaeobacteroidesNon-photosynthetic bacteriaSignificance
Membrane integrationSimilar membrane-spanning topologySimilar in most bacteriaConserved functional role
Association with energy metabolismPart of both respiratory and potential photosynthetic electron transportPrimarily respiratoryAdaptation to phototrophic lifestyle
Genomic contextPart of the nqr operonPart of nuo operon in E. coliReflects evolutionary divergence

Interestingly, photoferrotrophic Chlorobi like Chlorobium phaeobacteroides have metabolic versatility, including the capacity for nitrogen fixation, which may influence energy requirements and respiratory chain function . The functional adaptations of nuoA in these organisms may reflect this metabolic flexibility.

What methodological challenges exist in studying nuoA and how might researchers overcome them?

Studying nuoA presents several methodological challenges due to its nature as a small membrane protein:

  • Transmembrane orientation prediction: The small size and variable charge distribution make computational prediction unreliable. Solution: Use experimental approaches like fusion protein studies with reporters located in different cellular compartments .

  • Protein crystallization: Membrane proteins are notoriously difficult to crystallize. Solution: Cryo-EM has proven more successful and provides structural information in near-native conditions .

  • Functional assessment: As part of a large complex, isolating nuoA's specific contribution is challenging. Solution: Site-directed mutagenesis combined with reconstitution experiments can help elucidate specific roles.

  • Species variation: The function and properties of nuoA may vary between species. Solution: Comparative studies across multiple bacterial species can highlight conserved vs. variable features.

What are the potential applications of nuoA research for developing targeted antibacterial compounds?

NuoA presents an attractive target for antibacterial development for several reasons:

  • Exclusivity to prokaryotes: nuoA and its complex are exclusive to bacteria, with no direct homologues in human cells, reducing potential side effects .

  • Essential function: Inhibition of respiratory chain function is likely to severely impact bacterial viability, especially in obligate aerobes.

  • Structural insights: Recent Cryo-EM structures with bound inhibitors like korormicin A and aurachin D-42 provide templates for structure-based drug design .

  • Known inhibitor binding sites: The determined structures reveal how inhibitors bind to the complex, making rational drug design possible.

  • Potential for broad-spectrum activity: Targeting conserved regions of nuoA could affect multiple bacterial species.

The structural information about inhibitor binding sites provides a foundation for developing compounds that specifically inhibit bacterial respiratory chains without affecting human mitochondrial function.

How might studying nuoA in Chlorobium phaeobacteroides inform our understanding of ancient microbial metabolisms?

Chlorobium phaeobacteroides belongs to the green sulfur bacteria (Chlorobi), which appear to dominate modern ferruginous environments supporting photoferrotrophy . Studying nuoA in this context may provide insights into:

  • Evolution of respiratory chains: Understanding how electron transport chains evolved in photosynthetic bacteria might illuminate the development of these systems in early Earth environments.

  • Adaptation to low-oxygen environments: Green sulfur bacteria like Chlorobium phaeobacteroides can thrive in low-light, low-oxygen environments similar to those of the ancient Earth .

  • Integration of respiratory and photosynthetic electron transport: How these systems evolved to work together or separately under different conditions.

  • Nitrogen and sulfur metabolism connections: Photoferrotrophic Chlorobi have been shown to fix inorganic nitrogen and sulfur, which may have been crucial processes in nutrient-limited ancient oceans .

The metabolic versatility of these organisms, including the role of nuoA in their respiratory chains, may provide windows into how early life adapted to changing environmental conditions on Earth.

What cutting-edge techniques might advance our understanding of nuoA function in the next decade?

Several emerging technologies hold promise for deepening our understanding of nuoA function:

  • Time-resolved cryo-EM: Could capture dynamic conformational changes during electron transfer and ion pumping.

  • Single-molecule FRET studies: May elucidate short-lived conformational changes and protein dynamics during function.

  • Molecular dynamics simulations: Increasingly powerful computational approaches could model nuoA behavior within membrane environments.

  • In-cell structural biology: Techniques to study protein structure and interactions in their native cellular environment rather than in isolation.

  • Artificial intelligence approaches: Machine learning algorithms may help predict functional relationships and interactions not obvious from conventional analyses.

These approaches, combined with traditional biochemical and genetic methods, will likely provide a more complete picture of how nuoA contributes to bacterial energy metabolism and potentially inform new antimicrobial development strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.