Recombinant Chlorobium phaeobacteroides Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Biochemical Activity

The enzyme exhibits proteolytic activity under controlled conditions:

PropertyDetailsSource
Optimal pH7.4
Optimal Temperature37°C (retains activity up to 50°C)
SubstratesCasein, SecY (membrane protein), and self-degradation
InhibitionZinc chelators (e.g., EDTA) suppress activity

Mechanistic Insights:

  • Zinc Coordination: The HEXXH motif binds Zn²⁺, enabling endopeptidase activity .

  • Membrane Localization: Anchored to the cytoplasmic membrane, with the active site facing the cytoplasm .

  • Quality Control Role: Likely involved in degrading misfolded membrane proteins, similar to E. coli HtpX .

Research Applications and Experimental Utility

The recombinant htpX is utilized in diverse experimental contexts:

ApplicationDetailsSource
Protease Activity AssaysIn vivo substrate cleavage (e.g., SecY) and casein hydrolysis
ELISA KitsDetection of htpX in biological samples (e.g., strain DSM 266 or BS1)
Structural StudiesCrystallization and X-ray crystallography to elucidate catalytic mechanisms

Challenges in Production:

  • Toxicity: Expression in E. coli requires optimization to prevent inclusion body formation .

  • Refolding: Purified protein must be refolded in Zn²⁺-containing buffers for activity restoration .

Comparative Analysis Across Strains

Differences in htpX homologs from Chlorobium phaeobacteroides strains highlight strain-specific variations:

StrainUniProt IDLocusKey FeaturesSource
DSM 266A1BGS5Cpha266_1580291 aa; His-tagged for affinity purification
BS1B3EPQ3Cphamn1_2395303 aa; extended C-terminal region

Functional Implications:

  • Strain-Specific Activity: Variations in substrate specificity or efficiency may exist due to sequence differences.

  • Phylogenetic Context: Chlorobium htpX homologs cluster within the Chlorobiota phylum, sharing conserved indels with Bacteroidota and Fibrobacterota .

Production and Purification Methods

The recombinant protein is produced via heterologous expression:

StepDetailsSource
Host SystemE. coli (e.g., pT7 vector with His-tag)
PurificationNi-NTA affinity chromatography followed by gel filtration
Purity>90% as determined by SDS-PAGE

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Please note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
htpX; Cpha266_1580; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain DSM 266)
Target Names
htpX
Target Protein Sequence
MKRVVLFLFTNLAVMLVLSVSARVLGVDRFLTGNGLDMGMLLLFAALIGFGGSFISLLMS KTMAKWSTGARVIQQPANQNEVWLVDTVSQLSKKAGLAMPEVAIYDGAPNAFATGPSKSR SLVAVSTGLLQSMDRKQVEAVLAHEVAHIDNGDMVTLTLIQGVLNTFVIFLSRVIAYAID SFLRSDDDESGSPGIGYWISSIIFEIMFGILASVVVMYFSRKREYRADAGAAVLLGDRRP MIDALRALGGLQAGQLPKEMAASGIAGGGMMALFSSHPPLESRIAALESAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium phaeobacteroides Protease HtpX homolog and what is its significance in molecular biology?

The Protease HtpX homolog from Chlorobium phaeobacteroides (strain DSM 266) is a membrane-bound zinc metalloproteinase that belongs to the M48 family of proteases . This protein, encoded by the htpX gene, plays a critical role in membrane protein quality control mechanisms.

Chlorobium phaeobacteroides is a green sulfur bacterium (GSB) that contains bacteriochlorophyll e homologs and is often studied in environmental microbiology . The HtpX homolog in this organism is significant because it represents an evolutionarily conserved protease found across diverse bacterial species, providing insights into membrane protein maintenance mechanisms.

The protein structure contains multiple transmembrane domains that anchor it to the cytoplasmic membrane, with a distinctive HEXXH zinc-binding motif that characterizes its catalytic domain . Unlike commercial interest in this protein, its scientific significance lies in understanding fundamental cellular processes related to protein quality control, particularly in extremophilic or anaerobic organisms like C. phaeobacteroides.

How does HtpX protease function differ between Chlorobium phaeobacteroides and model organisms like E. coli?

While the E. coli HtpX is well-characterized as a heat-shock induced protease involved in membrane protein quality control, the Chlorobium phaeobacteroides homolog exhibits both conservation and divergence in function:

Conserved features:

  • Both contain the zinc-dependent metalloprotease domain with the HEXXH motif

  • Both are membrane-embedded with similar predicted topology

  • Both likely participate in protein quality control mechanisms

Divergent features:

  • Expression regulation may differ: E. coli htpX is regulated by σ32 (heat shock sigma factor) and is strongly induced during thermal stress , while regulation in C. phaeobacteroides is less characterized but may be adapted to its anaerobic, sulfur-based metabolism

  • Substrate specificity may vary based on the membrane protein composition differences between these evolutionarily distant organisms

  • The C. phaeobacteroides HtpX likely functions in the context of a photosynthetic membrane system, unlike the E. coli homolog

The study of these differences provides valuable insights into how proteolytic systems have adapted to different cellular environments while maintaining core functions in protein quality control.

What experimental approaches are most effective for studying the proteolytic activity of recombinant HtpX proteins?

Studying HtpX proteolytic activity requires carefully designed experimental approaches:

In vivo assay systems:

  • Model substrate approach: Researchers have developed a semiquantitative in vivo protease activity assay using engineered model substrates that allow convenient detection of HtpX protease activity

  • The model substrate approach typically involves fusion proteins containing cleavage sites recognized by HtpX, coupled with reporter proteins for easy detection

  • This system enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions

Biochemical characterization:

  • Purification under denaturing conditions followed by refolding in the presence of zinc chelators, then reactivation by adding Zn²⁺

  • Self-cleavage assays to monitor autocatalytic activity

  • Degradation assays using model substrates like casein

  • Membrane protein substrate cleavage assays (e.g., using solubilized SecY)

Expression systems:

  • E. coli-based expression systems with careful consideration of membrane targeting

  • Use of tags that don't interfere with membrane insertion or catalytic activity

  • Controlled expression to prevent toxicity from overexpression

These methodological approaches have been validated for E. coli HtpX and can be adapted for studying the C. phaeobacteroides homolog with appropriate modifications to account for potential differences in optimal conditions.

What are the conserved domains and critical residues in HtpX proteases across different bacterial species?

HtpX proteases across bacterial species contain several highly conserved domains and critical residues that are essential for their structure and function:

Conserved domains:

  • Transmembrane domains - Typically four hydrophobic regions (H1-H4), although the membrane topology may vary slightly between species

  • Zinc metalloprotease domain - Containing the signature HEXXH zinc-binding motif essential for catalytic activity

  • A region of approximately 100 residues that is particularly well conserved across eubacteria

Critical residues:

  • The HEXXH motif where histidine residues coordinate zinc ion binding

  • Glutamate residue in the HEXXH motif that serves as the catalytic base

  • Additional conserved residues that form the extended zinc-binding site

Conservation analysis across species:
Based on sequence alignment studies, HtpX shows remarkable conservation across diverse bacterial phyla, with several regions showing >50% identity across species . The evolutionary conservation of HtpX spans from Enterobacteriaceae to Aquifex aeolicus, Thermatoga, Spirochaetes, and many other bacterial groups, indicating its fundamental importance in bacterial physiology .

Mutations in these conserved regions typically result in reduced or abolished proteolytic activity, as demonstrated in experimental systems using model substrates .

How is the HtpX gene regulated under different environmental stress conditions?

The regulation of HtpX varies across bacterial species and responds to different environmental stressors:

Heat shock response:

  • In E. coli, htpX expression is controlled by the heat shock sigma factor σ32 (encoded by rpoH gene)

  • Temperature upshift induces a monocistronic transcript that results in increased HtpX protein levels

  • This heat shock regulation places htpX as part of the cellular stress response system

Other stress conditions:

  • In Pyrococcus furiosus (archaea), increased HtpX transcript levels are observed under heat shock conditions

  • In Haloferax volcanii (archaea), HtpX protein abundance increases during oxidative stress

  • In Stenotrophomonas maltophilia, htpX is upregulated in response to kanamycin exposure, linking it to antibiotic stress response

Regulatory networks:

  • HtpX often works in conjunction with other proteases like FtsH in E. coli

  • In some organisms, inactivation of other membrane proteases (like RhoII in archaea) leads to increased expression of HtpX homologs, suggesting compensatory regulation

  • In plants, some HtpX homologs may be involved in abiotic stress responses

This regulatory diversity highlights how HtpX has been integrated into different stress response pathways across diverse organisms, while maintaining its core function in membrane protein quality control.

How does HtpX interact with other components of bacterial membrane protein quality control systems?

HtpX functions as part of an integrated network of quality control components that maintain membrane protein homeostasis:

Functional relationship with FtsH:

  • HtpX works in conjunction with FtsH (another membrane-bound ATP-dependent protease) in E. coli

  • These two proteases appear to have overlapping but distinct substrate specificities

  • When FtsH is defective, HtpX becomes more important for clearing misfolded membrane proteins

Interaction with chaperone systems:

  • Evidence suggests coordination between HtpX and molecular chaperones

  • In Stenotrophomonas maltophilia, HtpX functions alongside the ClpA chaperone in intrinsic aminoglycoside resistance

  • The table below shows the relationship between these proteases and antibiotic resistance:

Protease/ChaperoneEffect on Aminoglycoside ResistanceMechanism
HtpXMajor determinant of intrinsic resistanceMembrane protein quality control
ClpAMajor determinant of intrinsic resistanceProtein disaggregation/remodeling
ClpPMinor effect on resistancePeptide degradation
ClpSMinor effect on resistanceSubstrate adaptor

Substrate sharing and handoff:

  • Some substrates may be partially processed by HtpX before being fully degraded by other proteases

  • In membrane protein degradation pathways, evidence suggests sequential action of different proteases

Compensatory mechanisms:

  • Deletion of htpX often leads to upregulation of other proteases

  • In archaeal systems, deletion of rhomboid protease (RhoII) leads to increased abundance of HtpX homologs

This network of interactions ensures robust membrane protein quality control even when individual components are compromised.

What are the methodological challenges in purifying active recombinant HtpX for biochemical studies?

Purifying active HtpX presents several technical challenges that researchers must overcome:

Self-degradation issues:

  • HtpX undergoes self-cleavage/degradation upon cell disruption or membrane solubilization

  • This autoproteolytic activity significantly reduces yield and complicates purification

Membrane protein solubilization:

  • As an integral membrane protein, HtpX requires careful detergent selection for solubilization

  • The choice of detergent must maintain protein stability while effectively extracting it from membranes

Maintaining enzymatic activity:

  • The zinc-dependent nature of HtpX requires special handling to preserve activity

  • Successful purification strategies include:

    • Purification under denaturing conditions

    • Refolding in the presence of zinc chelators to prevent premature activation

    • Controlled reactivation by zinc addition

Expression strategies:

  • Expression must be optimized to balance protein yield with avoiding toxicity

  • A recommended protocol based on published methods:

  • Express recombinant protein with His-tag in E. coli

  • Solubilize membranes with appropriate detergent (e.g., DDM or LDAO)

  • Purify under denaturing conditions (6-8M urea)

  • Perform on-column refolding with decreasing urea gradient

  • Elute in buffer containing zinc chelator (EDTA or 1,10-phenanthroline)

  • Activate enzyme by adding controlled amounts of Zn²⁺

  • Verify activity using model substrates or self-cleavage assay

This methodological approach has been successful for E. coli HtpX and can be adapted for the C. phaeobacteroides homolog .

What is the evolutionary significance of HtpX homologs across different bacterial phyla?

The evolutionary conservation of HtpX across diverse bacterial phyla reveals important insights into bacterial adaptation and the fundamental importance of membrane protein quality control:

Sequence conservation:

  • HtpX homologs have been identified across virtually all bacterial phyla from Proteobacteria to Firmicutes, Cyanobacteria, and extremophiles

  • Sequence analysis reveals regions of high conservation, especially around the catalytic HEXXH motif

  • A region of approximately 100 amino acids is particularly well conserved across eubacteria

Evolutionary distribution:
The following table illustrates the wide distribution of HtpX homologs identified through sequence analysis:

Bacterial GroupRepresentative OrganismIdentity to E. coli HtpXScore in BLAST
EnterobacteriaE. coli (reference)100%-
NeisseriaNeisseria sp.High matchHigh score
ThiobacillusThiobacillus sp.High matchHigh score
AquifexAquifex aeolicusIdentified via Neisseria HtpXSignificant
FirmicutesEnterococcus, BacillusIdentified via Aquifex HtpXSignificant
CyanobacteriaSynechocystisIdentified via chain of homologsModerate
SpirochaetesBorreliaIdentified via ThermatogaModerate
Green sulfur bacteriaChlorobium phaeobacteroidesSignificant homologySignificant

Functional conservation vs. adaptation:

  • The core proteolytic function appears conserved across species

  • Regulatory mechanisms have diversified, with HtpX being incorporated into different stress response networks:

    • Heat shock response in E. coli and archaea

    • Antibiotic stress response in S. maltophilia

    • Potential adaptation to photosynthetic membranes in Chlorobium

Horizontal gene transfer:

  • Evidence suggests HtpX genes may have been subject to horizontal gene transfer in some systems

  • For example, in GSB genomes, high signatures of horizontal gene transfer have been detected, reaching 24% of all genes in Chlorobaculum tepidum

This evolutionary analysis suggests that HtpX represents an ancient and fundamental component of bacterial physiology that has been maintained throughout evolution while adapting to diverse cellular environments.

How can recombinant HtpX be used to investigate membrane protein degradation pathways?

Recombinant HtpX serves as a valuable tool for investigating membrane protein degradation pathways through several methodological approaches:

Model substrate development:

  • Researchers have successfully created model substrates that allow monitoring of HtpX proteolytic activity both in vivo and in vitro

  • These engineered substrates typically contain:

    • A membrane-targeting domain

    • A cleavage site recognized by HtpX

    • A reporter moiety (e.g., GFP, enzyme tag) for detection

Substrate specificity mapping:

  • By using recombinant HtpX with various potential substrate proteins, researchers can map cleavage sites and determine sequence preferences

  • This has been demonstrated with SecY in E. coli, where HtpX was shown to cleave this membrane protein both in vivo and in vitro

Interaction studies:

  • Purified recombinant HtpX can be used in pull-down assays to identify interaction partners

  • Crosslinking studies with catalytically inactive mutants can trap substrates during processing

Reconstitution experiments:

  • Membrane protein degradation systems can be reconstituted using purified components

  • For example, combining recombinant HtpX with FtsH and model membrane substrates in proteoliposomes

Inhibitor development and screening:

  • The availability of purified recombinant HtpX enables screening for specific inhibitors

  • This has potential applications in developing adjuvants for antibiotic therapy, especially given the role of HtpX in aminoglycoside resistance

These approaches collectively enable researchers to dissect the mechanisms of membrane protein quality control and potentially develop new strategies for modulating these pathways in various contexts.

What role does HtpX play in bacterial antibiotic resistance mechanisms?

HtpX has been implicated in antibiotic resistance mechanisms, particularly against aminoglycosides:

HtpX and aminoglycoside resistance:

  • Studies in Stenotrophomonas maltophilia have demonstrated that HtpX is a primary determinant of intrinsic aminoglycoside resistance

  • The htpX gene is significantly upregulated upon kanamycin exposure

  • Deletion mutants (ΔhtpX) show increased susceptibility to aminoglycosides (2- to 16-fold reduction in MICs) but no change in susceptibility to spectinomycin (a bacteriostatic antibiotic that causes translational blockage without misreading)

Synergistic effects with other proteases:

  • Double mutants lacking both htpX and clpA (ΔclpAΔhtpX) exhibit substantially greater decreases in aminoglycoside resistance than single mutants

  • This suggests a coordinated role of these proteases in resistance mechanisms

Potential mechanisms:

  • HtpX may be involved in repairing or clearing damaged membrane proteins caused by aminoglycoside-induced mistranslation

  • It may play a role in maintaining the integrity of efflux pumps (such as the SmeYZ pump in S. maltophilia)

  • The table below summarizes experimental findings on protease deletion and aminoglycoside susceptibility:

Mutant StrainEffect on Aminoglycoside MICEffect on Spectinomycin MIC
ΔhtpX2-16 fold reductionNo change
ΔclpA2-16 fold reductionNo change
ΔclpP2-16 fold reductionNo change
ΔclpS2-16 fold reductionNo change
ΔclpAΔhtpXMost substantial decreaseNo change

Therapeutic implications:

  • HtpX inhibitors could potentially serve as aminoglycoside adjuvants, enhancing the efficacy of these antibiotics

  • This approach might be particularly valuable for treating resistant infections caused by organisms like S. maltophilia

This connection between membrane proteases and antibiotic resistance represents an emerging area of research with potential clinical applications.

How do mutations in conserved domains affect HtpX catalytic activity?

Mutations in conserved domains have significant effects on HtpX catalytic activity, providing insights into structure-function relationships:

HEXXH motif mutations:

  • The HEXXH motif is critical for zinc coordination and catalytic activity

  • Mutations of either histidine residue abolish zinc binding and eliminate proteolytic activity

  • The glutamate residue serves as the catalytic base; its mutation results in an inactive enzyme that still binds zinc

Transmembrane domain alterations:

  • Mutations affecting membrane topology can disrupt proper positioning of the catalytic domain

  • Even conservative substitutions in transmembrane regions can affect substrate access or enzyme stability

Experimental approaches to study mutations:

  • The development of in vivo semiquantitative protease activity assay systems has enabled detection of differential activities of HtpX mutants

  • These systems allow researchers to:

    • Introduce site-directed mutations in conserved regions

    • Express the mutant proteins in appropriate host cells

    • Measure relative proteolytic activity against model substrates

    • Correlate structural changes with functional outcomes

Structural insights from mutational analysis:

  • Mutational studies have helped elucidate:

    • The orientation of the catalytic domain relative to the membrane

    • The importance of specific residues in substrate recognition

    • Elements required for zinc coordination beyond the HEXXH motif

Conservation-based mutational approach:
By targeting residues with different degrees of conservation across species, researchers can distinguish between:

  • Universally essential residues (found in all HtpX homologs)

  • Clade-specific important residues (conserved within bacterial groups)

  • Variable regions that may confer substrate specificity differences

These mutational studies provide a foundation for understanding the molecular mechanisms of HtpX function and potentially for designing specific inhibitors with therapeutic applications.

What are the current hypotheses about the physiological substrates of Chlorobium phaeobacteroides HtpX?

While the physiological substrates of Chlorobium phaeobacteroides HtpX have not been definitively identified, several hypotheses exist based on comparative analysis with other bacterial systems and the unique physiology of this green sulfur bacterium:

Potential membrane protein substrates:

  • Photosynthetic apparatus components - Given the photosynthetic nature of C. phaeobacteroides, HtpX may be involved in maintaining the quality of photosynthetic membrane proteins

  • Bacteriochlorophyll synthesis enzymes - C. phaeobacteroides contains bacteriochlorophyll e homologs , and HtpX might regulate enzymes involved in pigment synthesis

  • Sulfur metabolism proteins - As a green sulfur bacterium, membrane proteins involved in sulfur oxidation could be substrates

Evidence from related systems:

  • In E. coli, HtpX has been shown to cleave SecY, a component of the protein secretion machinery

  • By extension, protein translocation components in C. phaeobacteroides might be regulated by HtpX

  • The unique ecological niche of C. phaeobacteroides (anaerobic, sulfur-based metabolism) suggests specialized membrane proteins that might require HtpX-mediated quality control

Viral interactions hypothesis:

  • Research has identified phages that can infect Chlorobium phaeobacteroides DSM 266

  • These phage-host interactions may involve HtpX in defensive or responsive mechanisms

  • Some viral genome fragments carry genes encoding photosystem components (psbA and psbD) , suggesting potential involvement of HtpX in regulating viral-modified photosynthetic processes

Methodological approaches to identify substrates:

  • Proteomics comparison between wild-type and ΔhtpX strains under stress conditions

  • Protein interaction studies using catalytically inactive HtpX mutants as "substrate traps"

  • In vitro degradation assays with purified HtpX and candidate membrane proteins

  • Comparative genomics analysis of gene neighborhoods and co-evolution patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.