Recombinant Chlorobium phaeobacteroides Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; Cpha266_2559; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Chlorobium phaeobacteroides (strain DSM 266)
Target Names
crcB
Target Protein Sequence
MLMKQVSAFLLVGIGGFLGSAARYGASLLLSPVAGGLPLATFSVNIIGCFFIGFISELAL STTLVSPESRLFLVTGFCGGFTTFSSYIFENASLLKDGQMLYTSAYLAGSVIGGFVALYS GTFFAKIWT
Uniprot No.

Target Background

Function
This protein plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog from Chlorobium phaeobacteroides and what is its primary function?

The CrcB homolog from Chlorobium phaeobacteroides is a membrane protein that functions as a fluoride ion transporter. This protein belongs to a family of dual-topology membrane proteins that form dimeric structures spanning the cell membrane. The primary function of CrcB is to mediate fluoride ion efflux from the cell, protecting against the toxic effects of fluoride accumulation. Research has established that CrcB adopts a unique dual topology configuration that allows it to function effectively in fluoride transport across bacterial membranes .

How is the CrcB gene organized in the Chlorobium phaeobacteroides genome?

The CrcB gene in Chlorobium phaeobacteroides exists as part of the genomic architecture typical of green sulfur bacteria of the Chlorobiaceae family. While specific plasmid organization varies among Chlorobium species, the presence of genomic elements such as antiphage systems appears to be an important feature. For instance, in the related Chlorobium phaeovibrioides, multiple antiphage systems have been identified, suggesting adaptation to significant phage pressure during evolution . The genomic context of CrcB is important for understanding its regulation and evolutionary history within green sulfur bacteria.

What computational methods can be used to predict the structure of recombinant CrcB protein?

For predicting the structure of recombinant CrcB protein, researchers can employ integrated computational approaches combining evolutionary co-variation analysis with advanced structural modeling. The GREMLIN method has proven effective for analyzing co-evolution of amino acids in membrane proteins like CrcB. This approach can be integrated with Rosetta structure prediction methodology, which employs Monte Carlo + Minimization searches through conformations with local structure consistent with the protein sequence . The workflow typically includes:

  • Initial identification of co-varying residue pairs using GREMLIN

  • Implementation of these pairs as distance restraints in Rosetta modeling

  • Optimization using both low-resolution energy functions (favoring hydrophobic burial and backbone hydrogen bonding) and detailed all-atom energy functions

  • Iterative hybridization using protocols like RosettaCM

To evaluate prediction quality, researchers can use the Rc score (ratio of observed to expected contact scores), which typically ranges from 0.7 to 1.2 for accurate predictions .

How can researchers experimentally determine the membrane topology of CrcB?

Experimental determination of CrcB's membrane topology requires a multi-faceted approach due to its dual-topology nature. Recommended methodologies include:

TechniqueApplication to CrcBAdvantagesLimitations
Cysteine scanning mutagenesisCreate single-cysteine mutants throughout the protein sequenceProvides residue-specific topological dataLabor-intensive
PhoA/LacZ fusion analysisGenerate reporter fusions at predicted loop regionsWell-established for topology mappingMay disrupt protein folding
Protease protection assaysAssess accessibility of protein regions to proteasesDirect physical evidence of topologyRequires pure protein preparations
Cryo-EM analysisDirect visualization of protein structureHigh-resolution structural dataTechnically challenging for membrane proteins

When analyzing results, researchers should consider the dual-topology nature of CrcB, which may complicate interpretation of experimental data. Cross-validation using multiple techniques is strongly recommended for confirming topology models .

What structural features distinguish CrcB from other membrane transporters?

CrcB exhibits distinctive structural features that differentiate it from other membrane transporters. Like EmrE, CrcB is a dual-topology membrane protein, but it has evolved specific modifications. The protein likely contains critical helix insertions between primary structural elements that cause specific helices to adopt inverted conformations in the membrane. This arrangement creates a pseudo-symmetric fold where domains interact in a manner that preserves functional interactions while enabling the specialized fluoride transport mechanism .

Unlike many transporters that form homo-oligomeric complexes from independently expressed subunits, CrcB appears to adopt an internal pseudo-symmetric fold resulting from gene duplication. This structure enables alternate access states involving the duplicated halves of the protein, which is crucial for its transport function .

What assays can be used to measure the fluoride transport activity of recombinant CrcB?

Several complementary approaches can be employed to measure the fluoride transport activity of recombinant CrcB:

  • Fluoride-sensitive electrode measurements:

    • Reconstitute purified CrcB in liposomes

    • Monitor fluoride concentration changes across the membrane over time

    • Calculate transport rates under various conditions (pH, temperature, competing ions)

  • Fluorescent probe-based assays:

    • Utilize fluoride-sensitive fluorescent probes (e.g., SNAFL derivatives)

    • Measure real-time transport in live cells or reconstituted systems

    • Enables high-throughput screening of transport activity

  • Growth complementation assays:

    • Express CrcB in fluoride-sensitive bacterial strains

    • Measure growth rescue under fluoride stress conditions

    • Compare growth rates to quantify relative transport efficiency

  • Isotope flux assays:

    • Use radioactive 18F to track transport kinetics

    • Provides precise quantification of transport rates

    • Allows determination of KM and Vmax values

When designing these experiments, researchers should carefully control for membrane potential, pH gradients, and potential competing ions that might affect transport measurements.

How does the dual topology of CrcB contribute to its function as a fluoride transporter?

The dual topology configuration of CrcB is integral to its function as a fluoride transporter. This arrangement creates a structural framework that facilitates the alternate access mechanism essential for ion transport. Based on structural similarities to other dual-topology transporters like EmrE, CrcB likely functions through a mechanism where the protein switches between alternate access states .

The inverted symmetry of the protein enables the formation of a central transport pathway that can alternately expose the fluoride binding site to either side of the membrane. This conformational switching is likely driven by proton gradients or other forms of cellular energy, allowing for efficient fluoride efflux against concentration gradients. The evolutionary adaptation of this dual topology arrangement represents a specialized solution for fluoride transport that has been conserved across bacterial species .

What role does CrcB play in bacterial fluoride resistance mechanisms?

CrcB plays a crucial role in bacterial fluoride resistance through several interconnected mechanisms:

Research indicates that bacteria lacking functional CrcB demonstrate significantly increased sensitivity to environmental fluoride. The expression of CrcB appears to be regulated in response to fluoride exposure, suggesting integration with cellular stress response systems. Understanding this role in resistance mechanisms has implications for both environmental adaptation of bacteria and potential antimicrobial development targeting fluoride homeostasis.

What expression systems are most effective for producing recombinant CrcB protein?

The production of functional recombinant CrcB requires careful selection of expression systems due to its membrane protein nature. A comparative analysis of expression systems reveals:

Expression SystemAdvantages for CrcBLimitationsOptimization Strategies
E. coli (C41/C43)High yield; established protocolsPotential folding issuesUse C43(DE3) strain; induce at low temperature (18°C)
Rhodobacter sphaeroidesNative membrane environment similar to ChlorobiumLower yieldOptimize promoter selection based on puf promoters
Cell-free systemsAvoids toxicity issuesHigh cost; lower yieldSupplement with lipids/detergents
Yeast (P. pastoris)Post-translational processingGlycosylation differencesUse strains with reduced glycosylation

For optimal results, expression should be conducted at reduced temperatures (16-20°C) with careful optimization of induction conditions. When using E. coli systems, the addition of specific chaperones can enhance proper folding. For functional studies, Rhodobacter-based systems may provide advantages due to similarity in membrane composition to the native Chlorobium environment .

What detergents and buffer conditions are optimal for CrcB extraction and purification?

Optimization of detergents and buffer conditions is critical for successful extraction and purification of functional CrcB:

Recommended detergents (in order of effectiveness):

  • n-Dodecyl-β-D-maltopyranoside (DDM) - 1-1.5% for extraction, 0.05% for purification

  • Lauryl maltose neopentyl glycol (LMNG) - 1% for extraction, 0.01% for purification

  • Digitonin - 1% for extraction, 0.1% for purification

Buffer optimization guidelines:

  • pH range: 7.0-8.0 (phosphate or Tris-based)

  • Salt concentration: 150-300 mM NaCl

  • Glycerol content: 10-15% to enhance stability

  • Addition of 1-5 mM fluoride may stabilize the protein structure

The purification workflow should include affinity chromatography (Ni-NTA for His-tagged constructs), followed by size exclusion chromatography to ensure homogeneity. Throughout the purification process, it is essential to maintain the detergent concentration above the critical micelle concentration (CMC) to prevent protein aggregation.

How can researchers assess the folding and stability of purified CrcB protein?

Multiple complementary techniques should be employed to thoroughly assess the folding and stability of purified CrcB:

  • Circular dichroism (CD) spectroscopy:

    • Analyze secondary structure composition

    • Monitor thermal stability through temperature-dependent CD profiles

    • Typical α-helical membrane proteins show characteristic minima at 208 and 222 nm

  • Fluorescence-based thermal shift assays:

    • Utilize environmentally sensitive dyes (CPM, SYPRO Orange)

    • Determine melting temperatures (Tm) under various conditions

    • Screen stabilizing additives and detergents

  • Limited proteolysis:

    • Assess accessibility of cleavage sites as indicator of folding

    • Compare digestion patterns with predicted structural models

    • Well-folded membrane proteins show resistance to proteolysis in detergent micelles

  • Analytical ultracentrifugation:

    • Determine oligomeric state and homogeneity

    • Confirm expected dimeric arrangement of CrcB

    • Calculate sedimentation coefficients for comparison with theoretical values

For quality control during purification, researchers should establish benchmark values for each of these parameters that correlate with functional activity in transport assays.

How can CrcB be used as a model system for studying membrane protein evolution?

CrcB represents an excellent model system for investigating membrane protein evolution due to several key attributes:

The relationship between CrcB and other dual-topology membrane proteins provides a framework for studying evolutionary processes. Particularly notable is the relationship between CrcB and EmrE, where structural comparisons reveal both conservation of functional mechanisms and divergence in specific structural elements. The CrcB homolog demonstrates how gene duplication events can lead to the development of specialized transport functions while maintaining core structural features .

Researchers can use comparative genomics approaches to trace the evolution of CrcB across bacterial lineages, especially focusing on adaptations to different environmental fluoride concentrations. This evolutionary analysis can be enhanced through ancestral sequence reconstruction techniques to identify key mutations that drove functional specialization of CrcB as a fluoride transporter.

What are the methodological approaches for studying CrcB interactions with other membrane components?

Investigating CrcB interactions with other membrane components requires specialized techniques for membrane protein interaction studies:

  • Genetic interaction mapping:

    • Conduct synthetic genetic array analysis

    • Identify genes showing synthetic lethality or suppression with crcB mutations

    • Map functional interaction networks

  • In vitro reconstitution systems:

    • Co-reconstitute CrcB with potential partner proteins in liposomes

    • Measure functional changes in transport activity

    • Analyze lipid requirements for optimal function

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers to capture transient interactions

    • Identify interaction partners through proteomics analysis

    • Map interaction interfaces at the residue level

  • Single-molecule tracking:

    • Label CrcB with fluorescent probes for live-cell imaging

    • Track diffusion patterns and interaction dynamics

    • Identify confined movement indicative of complex formation

These approaches can help reveal how CrcB functions within the broader context of bacterial membrane physiology and identify potential regulatory mechanisms controlling its activity.

How can structural information about CrcB inform the design of fluoride transport inhibitors?

Structural insights into CrcB can drive rational design of fluoride transport inhibitors through the following approaches:

  • Binding site identification:

    • Use computational methods like GREMLIN combined with Rosetta modeling to identify the fluoride binding pocket

    • Map conserved residues likely involved in fluoride coordination

    • Identify potential allosteric sites that might disrupt conformational changes

  • Structure-based virtual screening:

    • Generate a pharmacophore model based on the identified binding sites

    • Screen compound libraries for molecules with complementary features

    • Prioritize compounds predicted to disrupt the alternate access mechanism

  • Fragment-based design:

    • Identify small molecules that bind to subpockets within the transport channel

    • Link fragments to create high-affinity inhibitors

    • Optimize based on structure-activity relationships

The development of fluoride transport inhibitors could have significant implications for both antimicrobial development and research tools to probe transport mechanisms. Researchers should focus on compounds that specifically disrupt the conformational changes required for the alternate access mechanism, as these would provide the most selective inhibition of transport function.

What are common pitfalls in CrcB expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with CrcB that can be addressed through specific strategies:

ChallengeCauseSolution
Low expression yieldToxicity to host cellsUse tightly controlled induction systems; lower temperature (16°C) during induction
Protein aggregationImproper folding; detergent issuesScreen detergent panel; add lipids (0.1-0.5 mg/ml) during extraction
Loss of function during purificationDestabilizationInclude fluoride (1-5 mM) in all buffers; minimize time at room temperature
Heterogeneous oligomeric stateIncomplete solubilizationIncrease detergent concentration during extraction; use gentle solubilization (4°C, overnight)
Proteolytic degradationExposed flexible regionsAdd protease inhibitor cocktail; minimize purification time; keep samples at 4°C

Additionally, codon optimization for the expression host can significantly improve yields. For functional studies, consider using fusion partners that enhance folding and stability, such as GFP or MBP, which can be cleaved post-purification if needed.

How can researchers address challenges in reconstituting CrcB into liposomes for functional studies?

Successful reconstitution of CrcB into liposomes requires careful optimization of multiple parameters:

  • Lipid composition optimization:

    • Test different lipid mixtures (POPE:POPG ratios from 3:1 to 7:3)

    • Include cholesterol (0-20%) to modulate membrane fluidity

    • Consider adding native lipids extracted from Chlorobium if available

  • Reconstitution method selection:

    • Detergent dilution: Gentle but may result in lower protein incorporation

    • Detergent removal with Bio-Beads: Efficient but can denature sensitive proteins

    • Dialysis: Time-consuming but provides uniform vesicles

    • Direct incorporation during vesicle formation: Higher efficiency for stable proteins

  • Protein-to-lipid ratio optimization:

    • Start with 1:100 weight ratio

    • Test ratios ranging from 1:50 to 1:500

    • Monitor reconstitution efficiency by separation on sucrose gradients

  • Quality control procedures:

    • Freeze-fracture electron microscopy to confirm protein incorporation

    • Dynamic light scattering to verify vesicle size and homogeneity

    • Fluorescent labeling to determine protein orientation in the membrane

Researchers should systematically optimize each of these parameters and confirm functional incorporation using transport assays before proceeding to detailed kinetic measurements.

What strategies can help resolve contradictory results in CrcB functional studies?

When faced with contradictory results in CrcB functional studies, researchers should implement a systematic troubleshooting approach:

  • Experimental validation and controls:

    • Verify protein identity through mass spectrometry

    • Confirm activity using multiple independent assays

    • Include positive controls (known functional transporters) and negative controls (inactive mutants)

  • Parameter standardization:

    • Standardize buffer conditions, pH, temperature across experiments

    • Control membrane potential in transport assays

    • Document precise detergent concentrations and lipid compositions

  • Data integration approaches:

    • Develop mathematical models integrating data from multiple experimental approaches

    • Perform global fitting of data sets to identify consistent parameters

    • Conduct sensitivity analysis to identify parameters most affecting outcomes

  • Independent verification:

    • Collaborate with other laboratories to replicate key findings

    • Use complementary techniques to cross-validate results

    • Consider differences in protein constructs (tags, mutations) that might explain discrepancies

By systematically addressing these aspects, researchers can resolve contradictions and develop a more robust understanding of CrcB function and mechanism. Documentation of all experimental conditions in publications is critical for enabling reproducibility and resolution of contradictory findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.