Recombinant Chlorobium tepidum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; CT0019; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
atpF
Target Protein Sequence
MLTSGIILLEGGLLNPNPGLIFWTALTFLIVLVILRKTAWGPILSMLEERAKSIQSAIDR AHTAKDEAEAILKKNRDLLAKADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAK EEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTLDADKQKAVVNDMIKEMAASRN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This subunit is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links

KEGG: cte:CT0019

STRING: 194439.CT0019

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Chlorobium tepidum and why is its ATP synthase of scientific interest?

Chlorobium tepidum is a Gram-negative bacterium belonging to the green-sulfur phylum (Chlorobia). It performs anoxygenic photosynthesis using the reductive tricarboxylic acid cycle and was originally isolated from high-sulfide hot springs. The complete genome of C. tepidum TLS consists of a single circular chromosome of 2,154,946 bp, representing the first sequenced genome from the Chlorobia phylum . What makes C. tepidum particularly noteworthy is that its ATP synthase functions as an ATP-dependent enzyme, similar to eukaryotic ATP synthases rather than typical prokaryotic versions . This evolutionary distinction provides a valuable comparative model for understanding ATP synthase adaptation across domains of life and potentially reveals evolutionary intermediates between prokaryotic and eukaryotic energy coupling mechanisms.

The atpF gene encodes the b subunit of ATP synthase, which forms a critical component of the peripheral stalk connecting the F1 (catalytic) and F0 (membrane-embedded) portions of the ATP synthase complex. This structural role is essential for maintaining the proper spatial relationship between rotating and stationary parts during catalysis.

How does the structure and function of ATP synthase subunit b differ between Chlorobium tepidum and other bacterial species?

The ATP synthase subunit b (atpF) in C. tepidum maintains the general architecture seen in other species—an N-terminal membrane-spanning domain and an extended C-terminal cytoplasmic domain—but contains unique structural features related to its ATP-dependent functionality . While most prokaryotic ATP synthases operate primarily in the direction of ATP synthesis driven by proton motive force, the C. tepidum enzyme shows characteristics more similar to eukaryotic ATP synthases, which can function readily in ATP hydrolysis mode.

Comparative analysis of ATP synthase b subunits across species reveals both conserved features and distinctive adaptations:

SpeciesN-terminal RegionC-terminal RegionDistinctive Features
Chlorobium tepidumSingle transmembrane helixExtended α-helical regionUnique residues associated with ATP-dependent regulation
E. coliSingle transmembrane helixExtended α-helical region with dimerization motifsWell-characterized dimerization interface
CyanobacteriaSingle transmembrane helixVariable length helical regionAdaptations for thylakoid membrane
Mitochondria (eukaryotic)Single transmembrane helixExtended helical regionFeatures for ATP-dependent regulation

The unique positioning of C. tepidum ATP synthase as a prokaryotic enzyme with eukaryotic-like characteristics makes it an excellent model for understanding the evolution and molecular mechanisms of energy coupling in biological systems .

What genomic insights have been revealed about the atpF gene in Chlorobium tepidum?

Genomic analysis of C. tepidum has revealed several important insights about the atpF gene and its context. Phylogenomic analysis indicates likely gene duplications in biosynthetic pathways for photosynthesis and metabolism of sulfur and nitrogen . This genomic plasticity may have influenced the evolution of ATP synthase components, including atpF.

The genome sequencing of C. tepidum has enabled identification of genes that are highly conserved among photosynthetic species, many with previously unassigned functions that may play novel roles in photosynthesis or photobiology . The ATP synthase genes in C. tepidum are organized in an operon structure typical of bacteria, with the atpF gene positioned among other ATP synthase subunit genes.

The C. tepidum genome shows strong similarities between metabolic processes and many Archaeal species , which may help explain its unusual ATP synthase characteristics that bridge prokaryotic and eukaryotic features. This genomic context provides important insights for understanding the regulation and co-expression patterns of atpF with other energy metabolism genes.

What expression systems are most effective for producing recombinant Chlorobium tepidum atpF?

Expression of membrane proteins like atpF presents significant challenges due to potential toxicity, misfolding, and aggregation. For C. tepidum atpF, several expression systems should be considered:

  • Bacterial expression systems: Modified E. coli strains like C41(DE3) or C43(DE3), specifically designed for membrane protein expression, often yield the best results. These strains contain mutations that prevent the toxicity normally associated with overexpression of membrane proteins. Expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to minimize inclusion body formation.

  • Fusion protein approaches: Fusing atpF to solubility-enhancing partners such as maltose-binding protein (MBP) or SUMO can dramatically improve expression yields. This approach requires subsequent tag removal using specific proteases before functional studies.

  • Cell-free expression systems: These bypass cellular toxicity issues and allow direct incorporation of the protein into detergent micelles or lipid nanodiscs. While yields are typically lower, the protein quality is often superior for structural studies.

  • Yeast expression systems: Given C. tepidum ATP synthase's eukaryotic-like ATP-dependent characteristics , Pichia pastoris may provide a more compatible cellular environment for functional expression.

Typical yields for recombinant atpF expression:

Expression SystemAverage Yield (mg/L)AdvantagesLimitations
E. coli BL21(DE3)1-3Simple, inexpensiveHigh inclusion body formation
E. coli C41/C433-8Better for membrane proteinsModerate yields
Cell-free system0.5-1.5Direct incorporation into lipidsHigher cost, complex setup
Pichia pastoris5-15Higher yield, eukaryotic environmentLonger development time

The optimal expression system must be determined empirically through systematic screening, as membrane protein expression is often unpredictable and protein-specific.

What purification strategies provide the highest quality recombinant Chlorobium tepidum atpF protein?

Purifying recombinant C. tepidum atpF to homogeneity while maintaining its native structure requires a carefully designed strategy:

  • Membrane preparation and solubilization: Following cell lysis, membrane fractions should be isolated by ultracentrifugation. Solubilization requires careful detergent selection—mild detergents like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin are recommended to maintain structural integrity.

  • Affinity chromatography: A polyhistidine tag (similar to that used for S. cerevisiae ATP Sulfurylase/MET3 ) allows efficient initial purification using immobilized metal affinity chromatography (IMAC). Imidazole gradients should be optimized to minimize non-specific binding while maximizing target protein recovery.

  • Ion exchange chromatography: Based on the predicted isoelectric point of atpF, either cation or anion exchange chromatography can remove contaminants with different charge properties.

  • Size exclusion chromatography: This final polishing step separates residual aggregates and ensures a homogeneous preparation in a stabilizing buffer formulation.

A typical purification table might show:

Purification StepProtein Recovery (%)Purity (%)Critical Parameters
Membrane fraction1005-15Complete cell disruption
Detergent solubilization70-8015-25Detergent type and concentration
IMAC50-6075-85Imidazole concentration, pH
Ion exchange40-5085-95Salt gradient, buffer pH
Size exclusion30-45>95Flow rate, column resolution

The final protein should be maintained in a stabilizing buffer containing a detergent at concentrations slightly above its critical micelle concentration (CMC), typically with added glycerol (10-20%) and potentially specific lipids to enhance stability.

How can researchers assess the structural integrity of purified recombinant atpF?

Verifying the structural integrity of purified C. tepidum atpF is crucial before proceeding to functional studies. Multiple complementary techniques should be employed:

  • SDS-PAGE and Western blotting: To confirm protein identity, purity, and molecular weight, similar to the approach used for visualizing recombinant S. cerevisiae ATP-Sulfurylase/MET3 .

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content, particularly α-helical content which should be dominant in properly folded atpF. The spectrum should show characteristic minima at 208 and 222 nm.

  • Thermal stability assays: Differential scanning fluorimetry (DSF) or CD thermal melting can assess protein stability and identify buffer conditions that maximize thermostability.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): To determine the oligomeric state and detect any aggregation or degradation products.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map regions of stable secondary structure versus flexible regions.

A representative CD spectroscopy analysis might yield:

Secondary Structure ElementPredicted Content (%)Measured Content (%)Interpretation
α-helix60-7065.3Well-folded protein
β-sheet5-158.7Consistent with prediction
Turn structures10-1512.5Properly folded
Random coil10-2013.5Limited unfolded regions

Indicators of properly folded atpF include a predominant α-helical signature by CD, a cooperative thermal unfolding transition, a monodisperse peak on size exclusion chromatography, and resistance to limited proteolysis compared to denatured controls.

What experimental designs best assess the ATP-dependent functionality of Chlorobium tepidum atpF in reconstituted systems?

While atpF itself is not catalytically active, its role in the ATP synthase complex is critical for the enzyme's unique ATP-dependent functionality in C. tepidum . Several experimental approaches can assess this functionality:

  • Reconstitution strategies: For meaningful functional studies, atpF must be reconstituted with other ATP synthase subunits. Options include:

    • Co-expression of multiple subunits followed by purification of sub-complexes

    • Separate purification followed by in vitro reconstitution

    • Reconstitution into liposomes for proton pumping assays

  • ATP hydrolysis assays: Using either the malachite green phosphate detection kit (similar to that described for ATP Sulfurylase/MET3 ) or a coupled enzyme assay with pyruvate kinase and lactate dehydrogenase to measure ATP hydrolysis rates.

  • Proton pumping assays: Using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) to detect ATP-dependent proton translocation in proteoliposomes.

  • Binding studies: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure direct binding between atpF and other subunits or ATP.

A comparative functional analysis might show:

Experimental SystemATP Hydrolysis Activity (μmol Pi/min/mg)Proton Pumping Efficiency (%)Notes
Complete ATP synthase8.5-12.0100Full functionality
Complex lacking atpF0.5-1.0<5Essential role of atpF confirmed
Complex with mutated atpF3.0-6.030-50Partial disruption of function
+ Specific inhibitors0.2-0.5<2Confirmation of specificity

These experiments would establish whether atpF is properly incorporated into the complex and contributes to its ATP-dependent functionality as expected based on genomic and comparative analyses .

How do environmental conditions affect Chlorobium tepidum atpF function in experimental settings?

Considering that C. tepidum was isolated from high-sulfide hot springs , the effect of environmental conditions on atpF function is particularly relevant. Several factors warrant systematic investigation:

  • Temperature effects: C. tepidum's thermophilic nature suggests optimal functioning at elevated temperatures. Thermal stability assays should examine atpF stability from 20-70°C, with functional assays in reconstituted systems across this temperature range.

  • pH dependency: ATP synthase function is intrinsically linked to proton gradients. The optimal pH range for C. tepidum atpF function should be determined, considering both the stability of the protein and its functional interactions.

  • Ionic strength and specific ion effects: Particularly important are Mg²⁺ concentrations (critical for ATP binding) and Na⁺/K⁺ ratios that may affect membrane protein stability.

  • Lipid environment: The composition of the lipid bilayer can dramatically affect membrane protein function, especially for proteins like atpF that span the membrane.

A systematic study of temperature effects might yield:

Temperature (°C)Protein Stability (t½, hours)Complex Assembly (%)ATP Hydrolysis Activity (%)
25>1006540
35>1008570
4572100100
55489080
65126045
7522010

These data would help establish the optimal conditions for functional studies and provide insight into the evolutionary adaptations of C. tepidum ATP synthase to its natural thermal environment.

What methodologies can map the protein-protein interactions between atpF and other ATP synthase subunits?

Understanding the interaction network of atpF within the ATP synthase complex is essential for elucidating its structural and functional roles. Several complementary techniques can map these interactions:

  • Crosslinking coupled with mass spectrometry: Chemical crosslinkers of different lengths can capture spatial relationships between atpF and neighboring subunits. After crosslinking, proteolytic digestion and mass spectrometry analysis can identify specific residues involved in interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): By comparing hydrogen-deuterium exchange rates of atpF alone versus in complexes, regions involved in protein-protein interactions can be identified by their protection from exchange.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics and affinities between purified atpF and other ATP synthase subunits.

  • FRET-based interaction assays: By labeling atpF and potential interaction partners with fluorophore pairs, interactions can be monitored in real-time and in reconstituted membrane environments.

  • Co-immunoprecipitation with tagged constructs: Different truncations or mutations of atpF can identify specific regions required for interaction with other subunits.

A comprehensive interaction map might reveal:

Interaction PartnerBinding Region on atpFAffinity (Kd, nM)Effect of Disruption
α subunitC-terminal region (aa 120-156)85 ± 15Loss of F1 attachment
δ subunitMid-region (aa 90-120)120 ± 25Destabilized peripheral stalk
a subunitN-terminal region (aa 1-40)150 ± 30Loss of membrane anchoring
b' subunit (dimer partner)Full length45 ± 8Compromised stator function

These interaction data would help establish a detailed structural model of how atpF participates in the ATP synthase architecture and potentially contributes to the unique ATP-dependent properties of the C. tepidum enzyme.

How can site-directed mutagenesis of Chlorobium tepidum atpF reveal structure-function relationships?

Site-directed mutagenesis provides a powerful approach to dissect the functional contributions of specific residues in C. tepidum atpF. A systematic mutagenesis strategy should target:

  • Transmembrane domain residues: To understand membrane anchoring and lipid interactions. Mutations of key hydrophobic residues to alanine or charged residues can disrupt membrane integration.

  • Dimerization interface residues: The peripheral stalk typically involves dimerization of b subunits. Mutations at predicted interface residues can reveal the importance of dimer formation.

  • Subunit interaction sites: Based on interaction mapping data, mutations at interface residues can quantify their contribution to complex stability and function.

  • Conserved versus divergent residues: Comparing C. tepidum atpF with other bacterial and eukaryotic homologs can identify unique residues potentially responsible for its ATP-dependent characteristics .

A representative mutagenesis analysis might yield:

MutationRegionEffect on StructureEffect on Complex AssemblyEffect on ATP HydrolysisInterpretation
L24ATransmembraneReduced membrane associationDecreased by 60%Decreased by 80%Critical for membrane anchoring
R135EC-terminalDisrupted α-helixNo detectable assemblyInactiveEssential interface with F1
E95ADimerization interfaceAltered oligomeric stateDecreased by 40%Decreased by 60%Important for dimer stability
H42AUnique residueIntactIntactLoss of ATP dependencePotential ATP regulation site
Y108FConservedMinimal changeMinimal changeMinimal changeStructural role only

This mutational analysis would provide insights into residues critical for maintaining the unique ATP-dependent functionality of C. tepidum ATP synthase and could inform comparative studies with eukaryotic ATP synthases that share this characteristic.

What structural biology approaches provide the most informative data about atpF architecture?

Multiple structural biology techniques offer complementary insights into C. tepidum atpF structure and should be used in combination:

Comparative strengths of these methods:

TechniqueResolutionSample RequirementsSpecific AdvantagesLimitations
X-ray crystallography1.5-3.0 ÅDiffracting crystals (mg)Atomic resolutionDifficult for membrane proteins
Cryo-EM2.5-4.0 ÅPurified complex (μg)Visualization in full complexLower resolution for small components
NMRAtomicIsotope-labeled protein (mg)Dynamic informationSize limited (<30 kDa domains)
SAXS10-20 ÅMonodisperse sample (μg)Solution behavior, flexibilityNo atomic details
EPRSite-specificSpin-labeled protein (μg)Precise distance measurementsRequires mutation for labeling

The most comprehensive approach would combine these methods. For example, high-resolution structures of individual domains via X-ray crystallography could be fitted into cryo-EM density maps of the entire ATP synthase complex, with SAXS providing validation of the solution structure and EPR giving specific distance constraints.

How can researchers best design experiments to study the unique ATP-dependent properties of Chlorobium tepidum ATP synthase?

The ATP-dependent nature of C. tepidum ATP synthase, which distinguishes it from typical prokaryotic ATP synthases and aligns it more with eukaryotic versions , requires specialized experimental designs:

  • Comparative biochemistry approaches:

    • Side-by-side assays with typical prokaryotic ATP synthases (E. coli, thermophilic Bacillus PS3) and eukaryotic ATP synthases (bovine, yeast)

    • Chimeric constructs swapping domains between C. tepidum atpF and other species

    • Cross-species complementation studies

  • Advanced biophysical methods:

    • Single-molecule FRET to detect ATP-induced conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered dynamics upon ATP binding

    • Nanodiscs with controlled lipid compositions to examine membrane environment effects

  • Structure-guided approaches:

    • Molecular dynamics simulations comparing C. tepidum atpF with prokaryotic and eukaryotic homologs

    • In silico docking of ATP to identify potential binding sites

    • Rational design of mutations targeting predicted ATP-interaction regions

A comparative analysis might yield:

ATP Synthase SourceDirection BiasATP Binding Affinity (μM)Regulatory MechanismC. tepidum-like Properties
Chlorobium tepidumATP hydrolysis25-50Direct ATP bindingReference standard
E. coliATP synthesis200-300Proton motive forceMinimal
Bovine mitochondrialATP hydrolysis30-60IF1 inhibitor proteinSubstantial
Chimeric (C. tepidum/E. coli)Intermediate75-125MixedPartial

These experiments would help identify the molecular basis for C. tepidum ATP synthase's unique ATP-dependent characteristics and potentially reveal evolutionary adaptations that bridge prokaryotic and eukaryotic energy coupling mechanisms.

What strategies overcome common challenges in recombinant Chlorobium tepidum atpF expression and purification?

Researchers working with recombinant C. tepidum atpF frequently encounter several challenges that require systematic troubleshooting:

  • Protein aggregation during expression:

    • Lower induction temperature (16-18°C) and reduced inducer concentration

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J systems)

    • Fusion with solubility-enhancing partners like MBP or SUMO

    • Growth media optimization including osmolyte supplementation

  • Poor membrane extraction efficiency:

    • Systematic detergent screening panel (DDM, LMNG, digitonin, CHAPS, etc.)

    • Detergent mixture approaches (primary/secondary detergent combinations)

    • Alternative solubilization methods like styrene maleic acid lipid particles (SMALPs)

    • Optimization of temperature, time, and buffer composition during extraction

  • Protein instability during purification:

    • Addition of lipids during purification (E. coli polar lipids or synthetic mixtures)

    • Inclusion of glycerol or other stabilizing agents

    • Minimization of freeze-thaw cycles

    • Addition of reducing agents to prevent oxidative damage

  • Low functional activity:

    • Verification of complete expression (no premature termination)

    • Confirmation of proper folding through biophysical methods

    • Optimization of reconstitution protocols

    • Exploration of lipid requirements for activity

Comparative effectiveness of troubleshooting strategies:

ChallengeInterventionSuccess Rate (%)Implementation ComplexityImpact on Downstream Applications
Aggregation18°C expression65-75LowMinimal
AggregationChaperone co-expression70-80MediumMinimal
ExtractionDetergent screening80-90MediumModerate (detergent-dependent)
ExtractionSMALP approach50-60HighBeneficial (native lipid retention)
InstabilityLipid addition75-85LowBeneficial
InstabilityGlycerol (20%)80-90LowPotential interference in some assays
Low activityReconstitution optimization60-70HighEssential for functional studies

Systematic application of these strategies through a decision-tree approach can significantly improve the success rate for working with this challenging membrane protein.

How can researchers verify that their recombinant Chlorobium tepidum atpF preparations maintain native-like properties?

Ensuring that recombinant C. tepidum atpF maintains native-like properties is critical for valid functional studies. Several validation approaches should be employed:

  • Structural integrity verification:

    • Secondary structure analysis via circular dichroism spectroscopy compared to theoretical predictions

    • Thermal stability profiling to confirm the expected thermostability of this thermophilic protein

    • Limited proteolysis patterns compared to native ATP synthase preparations

  • Functional validation:

    • Complex assembly verification through co-immunoprecipitation or co-migration studies

    • ATP-dependent conformational changes measured by fluorescence or FRET

    • Interaction with known binding partners with expected affinity constants

  • Comparative analysis:

    • Side-by-side comparison with native ATP synthase where available

    • Comparison with homologous subunits from related species

    • Testing under physiologically relevant conditions for C. tepidum

  • In silico validation:

    • Molecular dynamics simulations to verify stable conformations

    • Structural model validation through energy minimization

    • Sequence-structure-function relationship analysis

A validation checklist might include:

Validation CriterionTechniqueExpected ResultRed Flags
Secondary structureCircular dichroism>60% α-helical content<40% α-helical content
Thermal stabilityDSF/CD meltingTm > 50°CTm < 40°C or non-cooperative melting
Oligomeric stateSEC-MALSDefined dimer or tetramerAggregation or concentration-dependent states
Complex formationPull-down assaysSpecific interaction with other subunitsNon-specific binding or no interaction
ATP responseTryptophan fluorescenceMeasurable change upon ATP additionNo response to ATP
ReconstitutionFlotation assays>80% incorporation into liposomesPoor membrane association

By systematically addressing these validation criteria, researchers can confidently establish that their recombinant atpF preparations reflect the native properties of the protein in C. tepidum.

What control experiments are essential when investigating the function of Chlorobium tepidum atpF in ATP synthase complexes?

Robust experimental design for C. tepidum atpF functional studies requires careful consideration of controls:

  • Protein quality controls:

    • Heat-denatured atpF as a negative control for structure-dependent functions

    • Concentration series to identify concentration-dependent effects

    • Multiple independent protein preparations to ensure reproducibility

  • Functional assay controls:

    • Known ATP synthase inhibitors (oligomycin, DCCD) as negative controls

    • Protonophores (CCCP, valinomycin+K⁺) to dissipate membrane potential

    • Mg²⁺ chelation (EDTA) to block ATP binding and hydrolysis

  • Specificity controls:

    • Closely related protein from a different species (e.g., E. coli subunit b)

    • Mutant versions with key residues altered

    • Chimeric constructs with domains swapped between species

  • System validation controls:

    • ATP hydrolysis without proton gradient to measure uncoupled activity

    • Empty liposomes for background signals

    • Buffer components individually tested for interference effects

An experimental design matrix should include:

Experiment TypePositive ControlNegative ControlAdditional ControlsInformation Gained
Complex assemblyComplete ATP synthaseIndividual subunitsMutant atpF versionsAssembly requirements
ATP hydrolysisReconstituted complexHeat-denatured complex±Inhibitors, ±Mg²⁺Catalytic activity verification
Proton pumpingATP + complexATP + uncoupled complex±IonophoresEnergy coupling efficiency
ATP bindingatpF + fluorescent ATP analogBinding-deficient mutantCompetition with ATPDirect binding evidence
ThermostabilityNative temperature rangeExtreme temperaturespH and salt variationsOptimal condition determination

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.